Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040445 [exp] 149 / 5e-46 ND / Lus10023559 [exp] 153 / 2e-45 ND / Lus10023556 [exp] 80 / 1e-20 ND / Lus10022836 [exp] 62 / 1e-12 ND / Lus10029057 [exp] 50 / 1e-08 ND / Lus10005394 [exp] 42 / 4e-06 ND / Lus10024121 [exp] 41 / 4e-05 ND / Lus10038309 [exp] 40 / 6e-05 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G156500 [exp] 111 / 4e-30 ND / Potri.011G108300 [exp] 71 / 6e-16 ND / Potri.004G038500 [exp] 70 / 6e-16 ND / Potri.001G388900 [exp] 69 / 4e-15 ND / Potri.011G047200 [exp] 66 / 2e-14 ND / Potri.011G047300 [exp] 65 / 8e-14 ND / Potri.001G388801 [exp] 64 / 2e-13 ND / Potri.001G387900 [exp] 64 / 3e-13 ND / Potri.001G388450 [exp] 63 / 4e-13 ND / Potri.001G388200 [exp] 63 / 4e-13 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0122 [flax] [poplar] UTRA PF12143 [flax] [poplar] PPO1_KFDV Protein of unknown function (DUF_B2219)
Representative CDS sequence Show only first row Show all	>Lus10040440 pacid=23174084 polypeptide=Lus10040440 locus=Lus10040440.g ID=Lus10040440.BGIv1.0 annot-version=v1.0 ATGGTGGAAGGGATTGTCATGAAGGCAGAGAAGTTTGTGAAGTTCGACGTCTACATCAACGTAGTCAACGAGACGATAATGAGCCCCAAGTACCGGGAGT TTGCAGGGACGTTCACCAATATCCCGGTGGGGGTATCGTTTGGTAAGAAGAAGATGTTGGAGCTAGGGATTTCAGAGGTGTTGGAGGATTTGGAGGCGGA TCGAGACCTATCTATATGGGTGACATTGATGCCGAGGACACAGAGTTGTAACAAGGTTACATTGATCGGCTAA
AA sequence Show only first row Show all	>Lus10040440 pacid=23174084 polypeptide=Lus10040440 locus=Lus10040440.g ID=Lus10040440.BGIv1.0 annot-version=v1.0 MVEGIVMKAEKFVKFDVYINVVNETIMSPKYREFAGTFTNIPVGVSFGKKKMLELGISEVLEDLEADRDLSIWVTLMPRTQSCNKVTLIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040440 [exp]	0	1
AT5G43500		ATARP9	actin-related protein 9 (.1.2)		Lus10021206 [exp]	6.2	0.8675
AT2G36780			UDP-Glycosyltransferase superf...		Lus10027739 [exp]	8.9	0.8624
AT2G26975			Ctr copper transporter family ...		Lus10040726 [exp]	11.0	0.7944
AT1G31720			Protein of unknown function (D...		Lus10034746 [exp]	11.0	0.8562
AT2G24840	MADS	DIA, AGL61	DIANA, AGAMOUS-like 61 (.1)		Lus10030663 [exp]	12.0	0.8639
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10019728 [exp]	12.4	0.8520
AT4G27290			S-locus lectin protein kinase ...		Lus10034815 [exp]	14.1	0.8449
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10042907 [exp]	21.4	0.8276
AT1G48820			Terpenoid cyclases/Protein pre...		Lus10008613 [exp]	22.1	0.8087
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10032406 [exp]	25.5	0.8432

Compare expression of checked genes

Lus10040440 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.