Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07900 93 / 1e-22 Mitochondrial transcription termination factor family protein (.1) AT1G21150 82 / 1e-18 Mitochondrial transcription termination factor family protein (.1) AT1G62110 72 / 3e-15 Mitochondrial transcription termination factor family protein (.1) AT1G62085 72 / 3e-15 Mitochondrial transcription termination factor family protein (.1) AT1G61980 72 / 5e-15 Mitochondrial transcription termination factor family protein (.1) AT1G61970 72 / 5e-15 Mitochondrial transcription termination factor family protein (.1.2) AT1G56380 69 / 6e-14 Mitochondrial transcription termination factor family protein (.1.2) AT3G46950 69 / 7e-14 Mitochondrial transcription termination factor family protein (.1) AT1G62120 68 / 1e-13 Mitochondrial transcription termination factor family protein (.1) AT1G61960 67 / 3e-13 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016551 [exp] 333 / 1e-117 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1) Lus10040818 [exp] 282 / 6e-97 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1) Lus10040817 [exp] 173 / 4e-53 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1) Lus10016550 [exp] 165 / 5e-50 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1) Lus10004957 [exp] 157 / 6e-47 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1) Lus10040819 [exp] 142 / 3e-42 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1) Lus10040820 [exp] 140 / 2e-40 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1) Lus10002883 [exp] 111 / 2e-29 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1) Lus10039174 [exp] 84 / 1e-21 AT1G21150 73 / 2e-16 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G022700 [exp] 96 / 1e-23 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1) Potri.004G013100 [exp] 92 / 2e-22 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1) Potri.004G012400 [exp] 92 / 3e-22 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1) Potri.004G012900 [exp] 92 / 4e-22 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1) Potri.004G013000 [exp] 91 / 9e-22 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1) Potri.012G046800 [exp] 91 / 1e-21 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1) Potri.008G216200 [exp] 88 / 5e-21 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1) Potri.012G046700 [exp] 87 / 2e-20 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1) Potri.015G038500 [exp] 86 / 3e-20 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1) Potri.011G005100 [exp] 86 / 3e-20 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [flax] [poplar] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Lus10040462 pacid=23173974 polypeptide=Lus10040462 locus=Lus10040462.g ID=Lus10040462.BGIv1.0 annot-version=v1.0 ATGATTAACCGGATGCAATCTGTTCTAAAGATTCGACACCTCCATAGCGATGGATTACTATGTTTCGCAGTTCGAAACCATCCGCGGCAGTTCTCGAACG AATCTGCTGGCAATCAAACCACCACCGCCGGCCCTATTGCTTTGTCTTACCTCATCAACGAATGTGGCATCCGTCCCGAAAAGGCCGCATCCGCCGTCAA ATACGCCCAATTCAAAACCCCAGAAAAGGCCAATTCGGTCTTGCAATTCTTCAGAACCCTCGGCTTCTCCACCGCCGACATCTCCCAAATCATCGGGAGG CGTCCTCGTCTGCTACTTTCCGATCCGGACAAACAATTCGCTCCCCGGATTAGTTTCCTGGAATCGCAAGGGTTTTCTCCCTCCGACATTGCTCAAGTCT TACTGAGAGGTCCTGAGATATTCTATTCCAGCGTAGCCAAACAGCTGCTACCCAATTTTGAATTCATCAAGAGCGCCGTGCTTCCCAGTGAGAATAACCA TAAAGAGTAA
AA sequence Show only first row Show all	>Lus10040462 pacid=23173974 polypeptide=Lus10040462 locus=Lus10040462.g ID=Lus10040462.BGIv1.0 annot-version=v1.0 MINRMQSVLKIRHLHSDGLLCFAVRNHPRQFSNESAGNQTTTAGPIALSYLINECGIRPEKAASAVKYAQFKTPEKANSVLQFFRTLGFSTADISQIIGR RPRLLLSDPDKQFAPRISFLESQGFSPSDIAQVLLRGPEIFYSSVAKQLLPNFEFIKSAVLPSENNHKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07900			Mitochondrial transcription te...		Lus10040462 [exp]	0	1
AT5G07900			Mitochondrial transcription te...		Lus10016551 [exp]	3.5	0.7742
AT3G09040			Pentatricopeptide repeat (PPR)...		Lus10009913 [exp]	12.3	0.8011
AT5G11430			SPOC domain / Transcription el...		Lus10013146 [exp]	13.0	0.7956
AT3G20320		ABCI15, TGD2	ATP-binding cassette I15, trig...		Lus10019360 [exp]	18.0	0.7826
AT1G04860		ATUBP2, UBP2	ubiquitin-specific protease 2 ...		Lus10016663 [exp]	24.6	0.7855
AT5G37570			Pentatricopeptide repeat (PPR-...		Lus10022701 [exp]	26.3	0.7641
AT5G18550	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10002880 [exp]	28.4	0.7342
AT4G19180			GDA1/CD39 nucleoside phosphata...		Lus10034777 [exp]	28.8	0.7841
AT5G11430			SPOC domain / Transcription el...		Lus10008108 [exp]	29.6	0.7690
AT4G33480			unknown protein		Lus10003851 [exp]	31.0	0.7290

Compare expression of checked genes

Lus10040462 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.