Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16970 85 / 3e-21 AT-AER alkenal reductase (.1) AT5G17000 83 / 2e-20 Zinc-binding dehydrogenase family protein (.1) AT5G16990 81 / 2e-19 Zinc-binding dehydrogenase family protein (.1) AT3G03080 80 / 3e-19 Zinc-binding dehydrogenase family protein (.1) AT1G26320 78 / 1e-18 Zinc-binding dehydrogenase family protein (.1.2) AT5G16960 76 / 6e-18 Zinc-binding dehydrogenase family protein (.1) AT5G37940 71 / 5e-16 Zinc-binding dehydrogenase family protein (.1) AT5G37980 66 / 2e-14 Zinc-binding dehydrogenase family protein (.1) AT5G38000 66 / 3e-14 Zinc-binding dehydrogenase family protein (.1) AT1G65560 64 / 1e-13 Zinc-binding dehydrogenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040177 [exp] 127 / 6e-37 AT5G37980 480 / 3e-171 Zinc-binding dehydrogenase family protein (.1) Lus10004380 [exp] 122 / 5e-35 AT5G37980 477 / 4e-170 Zinc-binding dehydrogenase family protein (.1) Lus10004379 [exp] 89 / 2e-22 AT5G17000 487 / 4e-174 Zinc-binding dehydrogenase family protein (.1) Lus10010988 [exp] 77 / 6e-18 AT5G16990 486 / 6e-174 Zinc-binding dehydrogenase family protein (.1) Lus10010989 [exp] 72 / 4e-16 AT5G16990 483 / 2e-172 Zinc-binding dehydrogenase family protein (.1) Lus10007853 [exp] 67 / 1e-14 AT5G16990 468 / 3e-166 Zinc-binding dehydrogenase family protein (.1) Lus10007832 [exp] 67 / 2e-14 AT5G16990 464 / 3e-165 Zinc-binding dehydrogenase family protein (.1) Lus10040589 [exp] 61 / 3e-12 AT1G65560 446 / 3e-156 Zinc-binding dehydrogenase family protein (.1) Lus10003638 [exp] 58 / 2e-11 AT3G03080 356 / 8e-124 Zinc-binding dehydrogenase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G143700 [exp] 83 / 2e-20 AT5G16970 495 / 2e-177 alkenal reductase (.1) Potri.017G004800 [exp] 82 / 4e-20 AT5G16970 409 / 8e-144 alkenal reductase (.1) Potri.017G005400 [exp] 82 / 6e-20 AT5G37980 488 / 3e-174 Zinc-binding dehydrogenase family protein (.1) Potri.017G002300 [exp] 79 / 4e-19 AT1G26320 488 / 2e-174 Zinc-binding dehydrogenase family protein (.1.2) Potri.017G002700 [exp] 78 / 1e-18 AT1G26320 490 / 4e-175 Zinc-binding dehydrogenase family protein (.1.2) Potri.017G006000 [exp] 78 / 1e-18 AT5G37980 493 / 2e-176 Zinc-binding dehydrogenase family protein (.1) Potri.017G005700 [exp] 76 / 7e-18 AT1G26320 496 / 1e-176 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G143800 [exp] 76 / 1e-17 AT1G26320 490 / 4e-175 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G142400 [exp] 73 / 1e-16 AT5G16990 491 / 1e-175 Zinc-binding dehydrogenase family protein (.1) Potri.017G002950 [exp] 69 / 4e-15 AT5G16970 464 / 7e-165 alkenal reductase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040466 pacid=23173984 polypeptide=Lus10040466 locus=Lus10040466.g ID=Lus10040466.BGIv1.0 annot-version=v1.0 ATGGTGGATGAGGAAGTACAGCAGAACAAGCAGGTGGTGCTGAAGGAATACGCCACCGGTTTCTCTAAGGAATCGCAATTCGGTGTCACCACCGTCTCGA TTCCCCTCAAAGTTCCCCATGGTTCCAATTCCGTCCTGTTCAAGAACCTCTACCTCTCCTGCGATCCTTACATGCGCGGCCGGATGACTCATCGTTGCCC CTCAGCATCTTCCACCCCAATCTCTCCGCGAAATCGTGCATCCCACCCTTCTGATCGAAGGTGA
AA sequence Show only first row Show all	>Lus10040466 pacid=23173984 polypeptide=Lus10040466 locus=Lus10040466.g ID=Lus10040466.BGIv1.0 annot-version=v1.0 MVDEEVQQNKQVVLKEYATGFSKESQFGVTTVSIPLKVPHGSNSVLFKNLYLSCDPYMRGRMTHRCPSASSTPISPRNRASHPSDRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16970		AT-AER	alkenal reductase (.1)		Lus10040466 [exp]	0	1
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10026419 [exp]	3.9	0.7152
AT1G12240		ATBETAFRUCT4, V...	VACUOLAR INVERTASE, Glycosyl h...		Lus10031144 [exp]	64.7	0.6708
AT2G30210		LAC3	laccase 3 (.1)		Lus10026400 [exp]	133.2	0.6231

Compare expression of checked genes

Lus10040466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.