Lus10040485 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47740 271 / 7e-92 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 222 / 3e-73 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 216 / 2e-70 PPPDE putative thiol peptidase family protein (.1)
AT5G47310 214 / 1e-69 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 212 / 3e-69 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 197 / 1e-58 unknown protein
AT4G25680 78 / 3e-17 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 76 / 3e-16 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 58 / 6e-10 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011291 495 / 0 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Lus10039492 325 / 3e-114 AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 286 / 5e-98 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 280 / 2e-95 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10005341 224 / 5e-74 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10018326 223 / 1e-73 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 222 / 2e-73 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 220 / 2e-72 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 213 / 8e-70 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G113168 311 / 7e-108 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 311 / 9e-108 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 305 / 2e-105 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 293 / 1e-100 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 291 / 3e-100 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 236 / 1e-78 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 228 / 2e-75 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 215 / 1e-70 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 213 / 1e-69 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 209 / 4e-68 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10040485 pacid=23174161 polypeptide=Lus10040485 locus=Lus10040485.g ID=Lus10040485.BGIv1.0 annot-version=v1.0
ATGGTCTCAGGAGGATCACAAAAGGGCAACAGGTGGCACTCCATCGATGCATCTCCTCTCAAGGCAAAGCTAGCTAACAAATTCTGCATCTTCCCAAAGT
CAAAGAACCTAGCAAGCTACACTCGTGGCGACACGCCAGTTTACCTCAATGTGTATGACCTCACTACCGCAAATGGTTATGTCTACTGGGCTGGCCTTGG
AATCTTCCACTCTGCAGTTGAAGTTCATGGTGTGGAGTATGCTTTCGGAGCCCATGACTTCTCGACCACAGGTGTCTTCGATGTAGAGCCACGAAACTGT
CCCGGTTACTTGTTCAGGAGGTCCTTGTTCATGGGGACGACCACGTTGGATCCTAAGCAGGTCAGGGAATTCATGGAGCGTCAGTCTGCTAACTACAATG
GTGATACGTATCATTTGATCTACAAGAACTGCAACCATTTTAGCCAGGATATCTGTTTCAAGCTCACCGGGAAGTCTATCCCTAAGTGGGTCAATCGGCT
CGCAAAAATAGGTTCTGTGTGCAACTGTGTTTTACCGGAGACGCTAAGGGATCCGAGCGGAGCCCACGAATCAAGTAGCCAAGACGAATGCGAGAGCGAG
AAGAAGAGGCTTAGGAGAAGTGCATTCAGTGCTGGGTTTTCATCAATGTCGATCTCTCAAGCGGAAGTTTCCATTTCATCATTGTTCAGACATTCTTACT
ACAACAACACCCGCCATGGGAGTTGA
AA sequence
>Lus10040485 pacid=23174161 polypeptide=Lus10040485 locus=Lus10040485.g ID=Lus10040485.BGIv1.0 annot-version=v1.0
MVSGGSQKGNRWHSIDASPLKAKLANKFCIFPKSKNLASYTRGDTPVYLNVYDLTTANGYVYWAGLGIFHSAVEVHGVEYAFGAHDFSTTGVFDVEPRNC
PGYLFRRSLFMGTTTLDPKQVREFMERQSANYNGDTYHLIYKNCNHFSQDICFKLTGKSIPKWVNRLAKIGSVCNCVLPETLRDPSGAHESSSQDECESE
KKRLRRSAFSAGFSSMSISQAEVSISSLFRHSYYNNTRHGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47740 PPPDE putative thiol peptidase... Lus10040485 0 1
AT2G29390 ATSMO2-2, SMO2-... Arabidopsis thaliana sterol 4-... Lus10040739 1.4 0.9208
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Lus10032505 2.0 0.9339
AT4G02100 Heat shock protein DnaJ with t... Lus10036335 2.4 0.9085
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10023995 5.9 0.8907
AT1G76880 Trihelix Duplicated homeodomain-like su... Lus10018887 5.9 0.8818
AT1G49750 Leucine-rich repeat (LRR) fami... Lus10019830 10.8 0.8805
AT1G47740 PPPDE putative thiol peptidase... Lus10011291 12.8 0.9056
AT3G16850 Pectin lyase-like superfamily ... Lus10037714 13.9 0.8812
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10026345 14.9 0.8765
AT3G05100 S-adenosyl-L-methionine-depend... Lus10019000 16.9 0.8212

Lus10040485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.