Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41905 37 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026313 [exp] 39 / 2e-05 AT2G41905 62 / 2e-14 unknown protein Lus10042354 [exp] 37 / 9e-05 AT2G41905 62 / 2e-14 unknown protein Lus10011301 [exp] 37 / 0.0004 AT3G20860 470 / 2e-157 NIMA-related kinase 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G052001 [exp] 37 / 0.0001 AT3G57690 / ARABINOGALACTAN-PROTEIN 23, arabinogalactan protein 23 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040498 pacid=23174189 polypeptide=Lus10040498 locus=Lus10040498.g ID=Lus10040498.BGIv1.0 annot-version=v1.0 ATGGACATGAAGAAGATCTCTTACGCCGTCGTCATCGCCGCCGCCTCTGTCTCCACCGTCATGGCTGCTGATGCCGGATTACTTGCTCCTTCCGCTGGCC CCTCCTCCGCAGGCGCCGCCCCTGCTTCAGCTCCCACCGCCGTCAGCGGCGCTGTCAGCTCAGCATTGCCTGCAATTGGGACCTTGGTTGGAGCTTCCCT TGTTTCAGTCTTCTCTTATTATTTCAATTGA
AA sequence Show only first row Show all	>Lus10040498 pacid=23174189 polypeptide=Lus10040498 locus=Lus10040498.g ID=Lus10040498.BGIv1.0 annot-version=v1.0 MDMKKISYAVVIAAASVSTVMAADAGLLAPSAGPSSAGAAPASAPTAVSGAVSSALPAIGTLVGASLVSVFSYYFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41905			unknown protein		Lus10040498 [exp]	0	1
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Lus10007640 [exp]	5.5	0.9159
AT3G52105			unknown protein		Lus10012208 [exp]	6.9	0.9015
AT1G62710		BETAVPE, BETA-V...	beta vacuolar processing enzym...		Lus10032236 [exp]	8.8	0.9165
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10029131 [exp]	8.8	0.9092
AT3G52790			peptidoglycan-binding LysM dom...		Lus10027407 [exp]	11.1	0.9145
AT1G08170			Histone superfamily protein (....		Lus10041351 [exp]	14.0	0.9072
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Lus10028888 [exp]	15.2	0.9025
AT1G22710		SUT1, ATSUC2, S...	SUCROSE TRANSPORTER 1, ARABIDO...		Lus10009428 [exp]	15.6	0.9158
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019029 [exp]	21.2	0.8978
					Lus10017792 [exp]	22.4	0.8701

Compare expression of checked genes

Lus10040498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.