Lus10040513 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08060 180 / 1e-59 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021149 226 / 3e-78 AT5G08060 156 / 2e-50 unknown protein
Lus10017854 214 / 2e-73 AT5G08060 186 / 5e-62 unknown protein
Lus10034681 214 / 4e-73 AT5G08060 186 / 6e-62 unknown protein
Lus10017855 204 / 3e-69 ND 170 / 2e-55
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G123700 170 / 8e-56 AT5G08060 146 / 3e-46 unknown protein
PFAM info
Representative CDS sequence
>Lus10040513 pacid=23157575 polypeptide=Lus10040513 locus=Lus10040513.g ID=Lus10040513.BGIv1.0 annot-version=v1.0
ATGGCGAAATCCTCCGCCGGAAGTTTCCTCCAGACTCTCAGGCGCTACATTAAGAAGCCATGGGAGATAACGGGTCCTTGCGCCGACCCCGAATACAGGC
TGGCCATCCCCAAAGCGGTGGAGTACCGAATCGAATGCCCTGCTTCAACCAAGGTGAAGCCTATCGTCCCATCCTCCGATCCTGAAACCGTCTTCGACAT
CACGTACCACACCCGTGATCAGCGCCGCAACCGCCCGCCCATCAAGCGCACCGTATTGAAGAAGGCCGATGTGGAGAAGATGATGAAGGAGAGGACAACC
TTCCAACCATCCGATTTCCCTCCTGTTTATCTGACCCAAGCTGCCGAGGAGCACATCGATACCCGTGGCGGTGGCTACCAGAAATGA
AA sequence
>Lus10040513 pacid=23157575 polypeptide=Lus10040513 locus=Lus10040513.g ID=Lus10040513.BGIv1.0 annot-version=v1.0
MAKSSAGSFLQTLRRYIKKPWEITGPCADPEYRLAIPKAVEYRIECPASTKVKPIVPSSDPETVFDITYHTRDQRRNRPPIKRTVLKKADVEKMMKERTT
FQPSDFPPVYLTQAAEEHIDTRGGGYQK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08060 unknown protein Lus10040513 0 1
AT1G02816 Protein of unknown function, D... Lus10009854 2.0 0.9159
AT3G18410 Complex I subunit NDUFS6 (.1.2... Lus10009665 3.0 0.9016
AT5G60800 Heavy metal transport/detoxifi... Lus10021432 3.2 0.8977
AT2G46800 ATMTP1, ZAT1, Z... ZINC TRANSPORTER OF ARABIDOPSI... Lus10030192 3.5 0.9099
AT1G11360 Adenine nucleotide alpha hydro... Lus10038561 3.5 0.8981
AT4G16490 ARM repeat superfamily protein... Lus10038811 6.2 0.8717
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Lus10019441 6.9 0.8792
AT3G25780 AOC3, AOC2 allene oxide cyclase 3 (.1) Lus10017571 8.5 0.8874
Lus10019698 8.8 0.8827
AT1G58330 ZW2 transcription factor-related (... Lus10005041 8.8 0.8837

Lus10040513 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.