Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10940 218 / 9e-68 ASG2 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) AT4G35140 66 / 6e-13 Transducin/WD40 repeat-like superfamily protein (.1) AT4G38480 64 / 2e-12 Transducin/WD40 repeat-like superfamily protein (.1) AT3G45620 64 / 2e-12 Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G56130 49 / 4e-07 THO3, AtTEX1 Transducin/WD40 repeat-like superfamily protein (.1) AT5G67320 42 / 0.0001 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1) AT1G64610 40 / 0.0005 Transducin/WD40 repeat-like superfamily protein (.1.2) AT2G43770 39 / 0.0005 Transducin/WD40 repeat-like superfamily protein (.1) AT5G58230 39 / 0.0008 MSI1, MEE70, ATMSI1 MATERNAL EFFECT EMBRYO ARREST 70, ARABIDOPSIS MULTICOPY SUPRESSOR OF IRA1, Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033290 [exp] 62 / 2e-11 AT3G45620 557 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10034751 [exp] 61 / 2e-11 AT3G45620 556 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10025088 [exp] 61 / 3e-11 AT4G35140 563 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10023993 [exp] 61 / 3e-11 AT4G35140 557 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10002860 [exp] 43 / 3e-05 AT2G43770 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10012230 [exp] 43 / 4e-05 AT2G43770 620 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10015407 [exp] 43 / 4e-05 AT3G49180 169 / 3e-49 ROOT INITIATION DEFECTIVE 3, Transducin/WD40 repeat-like superfamily protein (.1) Lus10043473 [exp] 43 / 5e-05 AT1G15440 1058 / 0.0 \(PERIODIC TRYPTOPHAN PROTEIN 2, periodic tryptophan protein 2 (.1.2) Lus10027113 [exp] 42 / 6e-05 AT5G56130 555 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G158300 [exp] 224 / 6e-70 AT5G10940 1080 / 0.0 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) Potri.002G103132 [exp] 162 / 9e-51 AT5G10940 390 / 2e-132 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) Potri.002G103216 [exp] 95 / 1e-25 AT5G10940 91 / 4e-22 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) Potri.009G139000 [exp] 64 / 2e-12 AT4G35140 602 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.004G178700 [exp] 64 / 2e-12 AT4G35140 538 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.001G470900 [exp] 45 / 7e-06 AT5G56130 586 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.019G096900 [exp] 42 / 7e-05 AT2G43770 645 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G144400 [exp] 39 / 0.0008 AT5G67320 671 / 0.0 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10040537 pacid=23157918 polypeptide=Lus10040537 locus=Lus10040537.g ID=Lus10040537.BGIv1.0 annot-version=v1.0 ATGGACCAACACGGGTTTCACGACGGCAATTTCTACAATTTGCTGGAGAGCAGATGCTTGGACGTTCGACATGACATTGTTGGCAACTTTCAGATGCATT CATCATTGATGCGGAGGCTCTCGCAAGAGAAGGAAATGGAAGGGCATCAGGGTTGCGTCAATGCTATAGCTTGGAATTCGAATGGTTCCCTCTTGATTTC TGGGTCAGATGATACCAGGGTTAGGGTATTCAATTTGTCTCGATTAAGCGGAAGAGGTCCTGAGGATACTAGCATTGTTCCTTCTGCACTCTACCAATGT CACTCTAGAAGAGTAAAGAAATTAGCTATTGAAGTTGGAAATCCGAATGTGGTATGGAGTGCCAGTGAAGATGGAACTTTGAGACAGCATGACCTTAGGG AGTGTGCTTCTTGTCCACCAGCAGGATCTTCTCCTCAAGAATGCCGCAATATTTTGGTGAGTTTTGGCTGA
AA sequence Show only first row Show all	>Lus10040537 pacid=23157918 polypeptide=Lus10040537 locus=Lus10040537.g ID=Lus10040537.BGIv1.0 annot-version=v1.0 MDQHGFHDGNFYNLLESRCLDVRHDIVGNFQMHSSLMRRLSQEKEMEGHQGCVNAIAWNSNGSLLISGSDDTRVRVFNLSRLSGRGPEDTSIVPSALYQC HSRRVKKLAIEVGNPNVVWSASEDGTLRQHDLRECASCPPAGSSPQECRNILVSFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10940		ASG2	ALTERED SEED GERMINATION 2, tr...		Lus10040537 [exp]	0	1
AT2G44900		ARABIDILLO-1, A...	F-box Armadillo protein 1, ARA...		Lus10028197 [exp]	2.6	0.8997
AT4G33210		SLOMO	SLOW MOTION, F-box family prot...		Lus10038067 [exp]	10.6	0.8638
AT5G47940			unknown protein		Lus10016406 [exp]	11.7	0.8437
AT5G24710			Transducin/WD40 repeat-like su...		Lus10028092 [exp]	14.3	0.8857
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10038725 [exp]	20.0	0.8424
AT3G10380		SEC8, ATSEC8	subunit of exocyst complex 8 (...		Lus10038694 [exp]	20.9	0.8739
AT2G07360			SH3 domain-containing protein ...		Lus10027587 [exp]	21.3	0.8837
AT3G63460		EMB2221	transducin family protein / WD...		Lus10019751 [exp]	22.6	0.8755
AT5G60170			RNA binding (RRM/RBD/RNP motif...		Lus10036138 [exp]	25.5	0.8360
AT3G07100		AtSEC24A, SEC24...	ENDOPLASMIC RETICULUM MORPHOLO...		Lus10013101 [exp]	25.8	0.8763

Compare expression of checked genes

Lus10040537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.