Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10940 268 / 6e-86 ASG2 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) AT4G35140 88 / 2e-20 Transducin/WD40 repeat-like superfamily protein (.1) AT4G38480 86 / 2e-19 Transducin/WD40 repeat-like superfamily protein (.1) AT3G45620 85 / 4e-19 Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G08560 53 / 4e-08 transducin family protein / WD-40 repeat family protein (.1.2) AT3G49660 52 / 7e-08 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT5G43920 48 / 1e-06 transducin family protein / WD-40 repeat family protein (.1) AT5G64730 45 / 2e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT4G02730 44 / 3e-05 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) AT1G15440 43 / 8e-05 ATPWP2 \(PERIODIC TRYPTOPHAN PROTEIN 2, periodic tryptophan protein 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034751 [exp] 88 / 3e-20 AT3G45620 556 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10023993 [exp] 88 / 4e-20 AT4G35140 557 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10025088 [exp] 87 / 4e-20 AT4G35140 563 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10033290 [exp] 87 / 8e-20 AT3G45620 557 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10022847 [exp] 55 / 7e-09 AT5G43920 550 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10011916 [exp] 54 / 2e-08 AT5G43920 557 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Lus10039636 [exp] 49 / 8e-07 AT3G49660 502 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Lus10001411 [exp] 49 / 1e-06 AT5G08560 695 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10001046 [exp] 49 / 1e-06 AT5G08560 713 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G158300 [exp] 327 / 2e-108 AT5G10940 1080 / 0.0 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) Potri.002G103066 [exp] 181 / 4e-58 AT5G10940 209 / 4e-64 ALTERED SEED GERMINATION 2, transducin family protein / WD-40 repeat family protein (.1.2) Potri.004G178700 [exp] 94 / 3e-22 AT4G35140 538 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.009G139000 [exp] 93 / 4e-22 AT4G35140 602 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.008G002700 [exp] 53 / 2e-08 AT5G08560 616 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.014G194100 [exp] 53 / 2e-08 AT5G43920 697 / 0.0 transducin family protein / WD-40 repeat family protein (.1) Potri.002G051900 [exp] 51 / 9e-08 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1) Potri.007G009500 [exp] 47 / 2e-06 AT3G49660 469 / 4e-168 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G148500 [exp] 47 / 2e-06 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) Potri.002G055800 [exp] 47 / 3e-06 AT5G08560 716 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10040538 pacid=23157700 polypeptide=Lus10040538 locus=Lus10040538.g ID=Lus10040538.BGIv1.0 annot-version=v1.0 ATGCCTGATAGAGAAGATTCTGACTATGACGAGGAGTTAGAATTGGATTTTGAAACTTCATTATCTGGTGATGAAGAACGTGAAATTGAGCCCAATACTC TTCATGGAAGCTTAAATCTGAGAATACACCGGAGAGGTGATTCAAGAGAAACAAGCTTTACAAATGGATCTTGTGGCTCGCCTTCTTCACAAAATGACCG GGCACCATATCAGCCAGAGCCAGCTGTTGACATGAAGCAGAGATTTATTGGACATTGCAATGTTGGGACAGACATAAAGCAGGCCAGTTTCCTGGGGCAA AGAGCTGACTATGTTGCTAGTGGAAGTGATGATGGTCGGTGGTTTATCTGGGAAAAGAGAACCGGTAGATTGATAAAAATGCTTCAAGGAGATGAAGCAG TTGTGAACTGTGTGCAGTCCCATCCGTTTGACTGTGTAGTAGCAACCAGTGGGATTGATAACACCATAAAGATTTGGACTCCAAGTGCTTCAGTGCCATC AATTTTTGCTGGGGGAGCAGCAGGACCTGAAAAATCTTATGTGCTCGAAGCAATGGAGAGCAACCAACGCGGACTGTGCAACAATCGTGAAGTTATCCTG TAA
AA sequence Show only first row Show all	>Lus10040538 pacid=23157700 polypeptide=Lus10040538 locus=Lus10040538.g ID=Lus10040538.BGIv1.0 annot-version=v1.0 MPDREDSDYDEELELDFETSLSGDEEREIEPNTLHGSLNLRIHRRGDSRETSFTNGSCGSPSSQNDRAPYQPEPAVDMKQRFIGHCNVGTDIKQASFLGQ RADYVASGSDDGRWFIWEKRTGRLIKMLQGDEAVVNCVQSHPFDCVVATSGIDNTIKIWTPSASVPSIFAGGAAGPEKSYVLEAMESNQRGLCNNREVIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10940		ASG2	ALTERED SEED GERMINATION 2, tr...		Lus10040538 [exp]	0	1
AT4G12790			P-loop containing nucleoside t...		Lus10041086 [exp]	2.0	0.9353
AT5G19930			Protein of unknown function DU...		Lus10033068 [exp]	2.4	0.9262
AT2G39445			Phosphatidylinositol N-acetylg...		Lus10010489 [exp]	4.6	0.9174
AT4G38070	bHLH		basic helix-loop-helix (bHLH) ...		Lus10002649 [exp]	8.8	0.8763
AT1G20920			P-loop containing nucleoside t...		Lus10029986 [exp]	9.0	0.8821
AT3G62240	C2H2ZnF		RING/U-box superfamily protein...		Lus10038048 [exp]	9.5	0.9037
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10000324 [exp]	10.2	0.8824
AT2G34750			RNA polymerase I specific tran...		Lus10005693 [exp]	10.7	0.8861
AT2G25970			KH domain-containing protein (...		Lus10004446 [exp]	13.8	0.9056
AT5G56260			Ribonuclease E inhibitor RraA/...		Lus10027126 [exp]	15.2	0.8971

Compare expression of checked genes

Lus10040538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.