Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29430 236 / 4e-82 RPS15AE ribosomal protein S15A E (.1) AT2G19720 231 / 4e-80 RPS15AB ribosomal protein S15A B (.1) AT2G39590 135 / 7e-42 Ribosomal protein S8 family protein (.1) AT5G59850 134 / 9e-42 Ribosomal protein S8 family protein (.1) AT1G07770 134 / 9e-42 RPS15A ribosomal protein S15A (.1.2) AT3G46040 132 / 1e-40 RPS15AD ribosomal protein S15A D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000975 [exp] 261 / 9e-92 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1) Lus10023429 [exp] 135 / 9e-42 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10040309 [exp] 134 / 1e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 134 / 1e-41 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 134 / 1e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 134 / 1e-41 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 134 / 1e-41 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G071250 [exp] 234 / 4e-81 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 234 / 4e-81 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.010G208700 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 138 / 3e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 137 / 9e-43 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [flax] [poplar] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Lus10040543 pacid=23157910 polypeptide=Lus10040543 locus=Lus10040543.g ID=Lus10040543.BGIv1.0 annot-version=v1.0 ATGGGAAGGAGGATACTGAACGATGCGTTGAGGGCCATAGTGAATGCGGAAAGGAGAGCCAAAGCTACAGTGGAGCTTCAACCTATTTCCACGGTCATGT CGTCTTTCCTTAGGATCATGAAAAATCGAGGGTACATAAAAAATTATCAAGTGTTTGACCCACAGCGAGTGGGGAGGATAACGGTTGAACTACAAGGAAG GGTAAAAGATTGCAAGGCACTTACTTACAGACAAGATATCAAGGCTAAGGAAATTGAAACTTACACAAAGCAAACTCTTCCAACCCGTCAGTGGGGTTAT GTAGTGATCTCAACTCCGGACGGTGTACTGGATCACGAGGAGGCAATTAAACGAAACGTAGGGGGTCAGGTTCTTGGTTACTTTCATTAG
AA sequence Show only first row Show all	>Lus10040543 pacid=23157910 polypeptide=Lus10040543 locus=Lus10040543.g ID=Lus10040543.BGIv1.0 annot-version=v1.0 MGRRILNDALRAIVNAERRAKATVELQPISTVMSSFLRIMKNRGYIKNYQVFDPQRVGRITVELQGRVKDCKALTYRQDIKAKEIETYTKQTLPTRQWGY VVISTPDGVLDHEEAIKRNVGGQVLGYFH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10040543 [exp]	0	1
AT1G48160			signal recognition particle 19...		Lus10011152 [exp]	1.0	0.9328
AT2G16720	MYB	AtY49, AtMYB7	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10028435 [exp]	8.2	0.8935
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Lus10036987 [exp]	8.3	0.8933
AT5G14290			Mitochondrial ribosomal protei...		Lus10041583 [exp]	10.2	0.8889
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	10.7	0.8570
					Lus10021189 [exp]	11.8	0.8775
AT5G51510			unknown protein		Lus10027200 [exp]	12.8	0.8646
AT1G55340			Protein of unknown function (D...		Lus10013616 [exp]	15.2	0.8575
AT2G21150		XCT	XAP5 CIRCADIAN TIMEKEEPER, XAP...		Lus10012170 [exp]	21.4	0.8793
AT1G68560		AXY3, TRG1, XYL...	thermoinhibition resistant ger...		Lus10021679 [exp]	21.6	0.8190

Compare expression of checked genes

Lus10040543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.