Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26210 228 / 7e-79 Mitochondrial ATP synthase subunit G protein (.1.2) AT4G29480 224 / 2e-77 Mitochondrial ATP synthase subunit G protein (.1) AT2G19680 220 / 7e-76 Mitochondrial ATP synthase subunit G protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040553 [exp] 254 / 3e-89 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10007995 [exp] 252 / 8e-88 AT4G26210 225 / 6e-77 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10001771 [exp] 250 / 1e-87 AT4G26210 224 / 3e-77 Mitochondrial ATP synthase subunit G protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G055700 [exp] 228 / 1e-78 AT4G26210 210 / 9e-72 Mitochondrial ATP synthase subunit G protein (.1.2) Potri.006G232000 [exp] 218 / 5e-75 AT4G29480 212 / 2e-72 Mitochondrial ATP synthase subunit G protein (.1) Potri.006G231900 [exp] 210 / 6e-72 AT4G29480 181 / 3e-60 Mitochondrial ATP synthase subunit G protein (.1) Potri.018G055501 [exp] 130 / 4e-40 AT2G19680 130 / 2e-40 Mitochondrial ATP synthase subunit G protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04718 [flax] [poplar] ATP-synt_G Mitochondrial ATP synthase g subunit
Representative CDS sequence Show only first row Show all	>Lus10040544 pacid=23157602 polypeptide=Lus10040544 locus=Lus10040544.g ID=Lus10040544.BGIv1.0 annot-version=v1.0 ATGGCGTCCAAATTAATGCAATTGCAATCTAAAGCTTGCCAAGCGTCTAAGTTTGTGTCTAAGCATGGCACTACCTACTACAAACAGTTACTGGAACAGA ACAAGAAATACATTCAGGAGCCCGCTAGTGTTGAGAAGTGCAATGAATTGTCTAAGCAATTGTTTTACACTCGGCTAGCCAGTATCCCGGGTAGAAATGA AGCATTCTGGAAGGAGCTAGACTACGTGAAGAACTTATGGAAGAACAGGCAGGAGCTAAAGGTTGAGGATGCAGGAGTTGCTGCATTGTTTGGACTTGAG TGCTTCGCATGGTATTGTGCAGGTGAAATCATTGGGAGGGGATTCACCTTCACCGGCTATTACCCTTGA
AA sequence Show only first row Show all	>Lus10040544 pacid=23157602 polypeptide=Lus10040544 locus=Lus10040544.g ID=Lus10040544.BGIv1.0 annot-version=v1.0 MASKLMQLQSKACQASKFVSKHGTTYYKQLLEQNKKYIQEPASVEKCNELSKQLFYTRLASIPGRNEAFWKELDYVKNLWKNRQELKVEDAGVAALFGLE CFAWYCAGEIIGRGFTFTGYYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26210			Mitochondrial ATP synthase sub...		Lus10040544 [exp]	0	1
AT5G07475			Cupredoxin superfamily protein...		Lus10012165 [exp]	2.8	0.8061
AT4G32530			ATPase, F0/V0 complex, subunit...		Lus10000694 [exp]	20.1	0.7672
AT3G13410			unknown protein		Lus10010298 [exp]	25.9	0.7542
AT1G55840			Sec14p-like phosphatidylinosit...		Lus10043160 [exp]	35.2	0.7564
AT2G17570			Undecaprenyl pyrophosphate syn...		Lus10032757 [exp]	37.5	0.7607
AT3G24160		PMP	putative type 1 membrane prote...		Lus10000760 [exp]	44.5	0.7336
AT1G68100		IAR1	IAA-ALANINE RESISTANT 1, ZIP m...		Lus10042480 [exp]	49.2	0.7377
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10032894 [exp]	54.5	0.7457
AT5G47960		SMG1, AtRABA4c	SMALL MOLECULAR WEIGHT G-PROTE...		Lus10014732 [exp]	58.9	0.7045
AT1G05940		CAT9	cationic amino acid transporte...		Lus10028195 [exp]	66.0	0.7268

Compare expression of checked genes

Lus10040544 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.