Lus10040545 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10040545 pacid=23157670 polypeptide=Lus10040545 locus=Lus10040545.g ID=Lus10040545.BGIv1.0 annot-version=v1.0
ATGTCTGGTGAAGACAACGACCACGAGCTGTCGCCGTCCAGCAAGCGGCAGTCTCCCAACCTCTATCCTCTCCTTTCTGTCTGTCCACTTCTAGGAGGAC
AAACCGACGCCACCGCTCCGGCCGATCTACTCCTCTCGGGGATCTTTTGCAGCAAAACGAAGTCTTACGGGCGAGTTGAAAAAGGTAGGTATGTTCCAAT
CGCTTTTTGCTCGATTTCTGATTTCATCCAGCTCTTAACCCTAGCTACGCTTTTGGATAGAGCATTCGGGAAAGGGGTGGATAAGACTACGAAGTCTGGG
GACTCGAATAGGTAG
AA sequence
>Lus10040545 pacid=23157670 polypeptide=Lus10040545 locus=Lus10040545.g ID=Lus10040545.BGIv1.0 annot-version=v1.0
MSGEDNDHELSPSSKRQSPNLYPLLSVCPLLGGQTDATAPADLLLSGIFCSKTKSYGRVEKGRYVPIAFCSISDFIQLLTLATLLDRAFGKGVDKTTKSG
DSNR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040545 0 1
AT1G55790 Domain of unknown function (DU... Lus10032899 2.0 0.8231
AT1G51990 O-methyltransferase family pro... Lus10033647 2.2 0.8954
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10024900 2.4 0.8532
AT1G10385 Vps51/Vps67 family (components... Lus10033648 5.5 0.8364
AT5G14870 ATCNGC18 cyclic nucleotide-gated channe... Lus10039415 5.9 0.7996
AT5G01300 PEBP (phosphatidylethanolamine... Lus10003388 8.4 0.7931
AT1G08315 ARM repeat superfamily protein... Lus10006007 8.8 0.7948
AT1G14185 Glucose-methanol-choline (GMC)... Lus10024728 9.0 0.7813
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10023810 9.5 0.7517
AT5G08450 unknown protein Lus10004298 10.2 0.7560

Lus10040545 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.