Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26210 228 / 7e-79 Mitochondrial ATP synthase subunit G protein (.1.2) AT4G29480 224 / 2e-77 Mitochondrial ATP synthase subunit G protein (.1) AT2G19680 220 / 7e-76 Mitochondrial ATP synthase subunit G protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040544 [exp] 254 / 3e-89 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10007995 [exp] 252 / 8e-88 AT4G26210 225 / 6e-77 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10001771 [exp] 250 / 1e-87 AT4G26210 224 / 3e-77 Mitochondrial ATP synthase subunit G protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G055700 [exp] 228 / 1e-78 AT4G26210 210 / 9e-72 Mitochondrial ATP synthase subunit G protein (.1.2) Potri.006G232000 [exp] 218 / 5e-75 AT4G29480 212 / 2e-72 Mitochondrial ATP synthase subunit G protein (.1) Potri.006G231900 [exp] 210 / 6e-72 AT4G29480 181 / 3e-60 Mitochondrial ATP synthase subunit G protein (.1) Potri.018G055501 [exp] 130 / 4e-40 AT2G19680 130 / 2e-40 Mitochondrial ATP synthase subunit G protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04718 [flax] [poplar] ATP-synt_G Mitochondrial ATP synthase g subunit
Representative CDS sequence Show only first row Show all	>Lus10040553 pacid=23157769 polypeptide=Lus10040553 locus=Lus10040553.g ID=Lus10040553.BGIv1.0 annot-version=v1.0 ATGGCGTCCAAATTAATGCAATTACAATCTAAAGCGTGCCAAGCGTCTAAGTTTGTGTCTAAGCATGGCACTACCTACTACAAACAGTTACTGGAACAGA ACAAGAAATACATTCAGGAGCCCGCTAGTGTAGAGAAGTGCAATGAATTGTCTAAGCAATTGTTTTACACTCGGCTAGCCAGTATCCCGGGAAGAAATGA AGCATTCTGGAAGGAGCTGGACTACGTGAAGAACTTATGGAAGAACAGGCAGGAGCTAAAGGTTGAGGACGCAGGAGTTGCTGCATTGTTTGGACTTGAG TGCTTCGCATGGTATTGTGCTGGTGAAATCATTGGGAGGGGATTCACCTTCACCGGCTACTACCCTTGA
AA sequence Show only first row Show all	>Lus10040553 pacid=23157769 polypeptide=Lus10040553 locus=Lus10040553.g ID=Lus10040553.BGIv1.0 annot-version=v1.0 MASKLMQLQSKACQASKFVSKHGTTYYKQLLEQNKKYIQEPASVEKCNELSKQLFYTRLASIPGRNEAFWKELDYVKNLWKNRQELKVEDAGVAALFGLE CFAWYCAGEIIGRGFTFTGYYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G26210			Mitochondrial ATP synthase sub...		Lus10040553 [exp]	0	1
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10014426 [exp]	3.3	0.7746
AT5G15220			Ribosomal protein L27 family p...		Lus10010822 [exp]	5.3	0.7063
AT5G46160			Ribosomal protein L14p/L23e fa...		Lus10023296 [exp]	12.8	0.7216
AT3G11591			unknown protein		Lus10024722 [exp]	30.7	0.6591
AT4G20150			unknown protein		Lus10038391 [exp]	42.1	0.7073
AT3G17210		ATHS1	A. THALIANA HEAT STABLE PROTEI...		Lus10000094 [exp]	43.1	0.6444
AT1G76860			Small nuclear ribonucleoprotei...		Lus10042341 [exp]	51.9	0.6923
AT5G09510			Ribosomal protein S19 family p...		Lus10041168 [exp]	58.2	0.6835
AT1G16000			unknown protein		Lus10023116 [exp]	79.8	0.6351
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10034392 [exp]	88.2	0.6533

Compare expression of checked genes

Lus10040553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.