Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021604 [exp] 57 / 8e-12 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040587 pacid=23157702 polypeptide=Lus10040587 locus=Lus10040587.g ID=Lus10040587.BGIv1.0 annot-version=v1.0 ATGGCTCCTGCTGCTGCCCCTGGTGGTGCATCAAGTGGAATTTCACCATCTGGGTCAGGGGAAGGAGGCGATGAGATGATTAAAGCTCCAGCACCATCCC CAGTTGGAGCTGGCTTAACTACTGGTTCGGCACCTGCTCTGCATTTCTCATTTGCGGCTGCAACCCTTGTAGTTGCTGCTGCTGCTTTCTACACCACCTT TTGA
AA sequence Show only first row Show all	>Lus10040587 pacid=23157702 polypeptide=Lus10040587 locus=Lus10040587.g ID=Lus10040587.BGIv1.0 annot-version=v1.0 MAPAAAPGGASSGISPSGSGEGGDEMIKAPAPSPVGAGLTTGSAPALHFSFAAATLVVAAAAFYTTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040587 [exp]	0	1
AT3G45230			hydroxyproline-rich glycoprote...		Lus10041306 [exp]	1.0	0.9713
AT3G14240			Subtilase family protein (.1)		Lus10013187 [exp]	2.0	0.9473
AT2G01610			Plant invertase/pectin methyle...		Lus10038645 [exp]	3.0	0.9447
AT2G34700			Pollen Ole e 1 allergen and ex...		Lus10014013 [exp]	3.6	0.9262
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10018016 [exp]	7.1	0.9229
AT4G23490			Protein of unknown function (D...		Lus10024662 [exp]	9.3	0.9074
AT4G38400		ATEXPL2, ATHEXP...	EXPANSIN L2, expansin-like A2 ...		Lus10025116 [exp]	9.4	0.9306
AT3G49750		AtRLP44	receptor like protein 44 (.1)		Lus10011561 [exp]	10.0	0.9416
					Lus10016903 [exp]	10.0	0.9325
AT4G24910			Protein of unknown function (D...		Lus10002345 [exp]	10.8	0.9436

Compare expression of checked genes

Lus10040587 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.