Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05530 57 / 5e-11 UGT75B2, UGT2 UDP-GLUCOSYL TRANSFERASE 2, UDP-glucosyl transferase 75B2 (.1) AT1G05560 55 / 3e-10 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1) AT4G14090 54 / 5e-10 UDP-Glycosyltransferase superfamily protein (.1) AT4G15550 51 / 7e-09 IAGLU indole-3-acetate beta-D-glucosyltransferase (.1) AT1G24100 47 / 2e-07 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT2G31750 41 / 3e-05 UGT74D1 UDP-glucosyl transferase 74D1 (.1) AT2G23210 40 / 4e-05 UDP-Glycosyltransferase superfamily protein (.1) AT2G36970 40 / 7e-05 UDP-Glycosyltransferase superfamily protein (.1) AT4G15490 39 / 0.0002 UGT84A3 UDP-Glycosyltransferase superfamily protein (.1) AT2G43820 38 / 0.0002 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021610 [exp] 110 / 8e-30 AT1G05560 372 / 6e-125 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1) Lus10015515 [exp] 94 / 7e-24 AT4G15550 379 / 3e-127 indole-3-acetate beta-D-glucosyltransferase (.1) Lus10019989 [exp] 89 / 3e-22 AT4G15550 379 / 5e-127 indole-3-acetate beta-D-glucosyltransferase (.1) Lus10009412 [exp] 47 / 2e-07 AT2G43820 474 / 1e-165 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10020556 [exp] 47 / 2e-07 AT2G43820 472 / 1e-164 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10006352 [exp] 45 / 9e-07 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10013924 [exp] 44 / 2e-06 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10008742 [exp] 44 / 2e-06 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2) Lus10024118 [exp] 44 / 3e-06 AT1G05675 375 / 2e-126 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G146000 [exp] 77 / 7e-18 AT4G15550 429 / 2e-147 indole-3-acetate beta-D-glucosyltransferase (.1) Potri.002G236500 [exp] 70 / 2e-15 AT4G15550 436 / 3e-150 indole-3-acetate beta-D-glucosyltransferase (.1) Potri.002G236400 [exp] 70 / 2e-15 AT1G05560 442 / 1e-152 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1) Potri.016G052500 [exp] 62 / 1e-12 AT4G15550 419 / 3e-143 indole-3-acetate beta-D-glucosyltransferase (.1) Potri.006G055600 [exp] 61 / 3e-12 AT4G15550 442 / 2e-152 indole-3-acetate beta-D-glucosyltransferase (.1) Potri.015G071900 [exp] 46 / 4e-07 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1) Potri.017G032300 [exp] 46 / 4e-07 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1) Potri.009G095500 [exp] 45 / 6e-07 AT2G23260 421 / 2e-144 UDP-glucosyl transferase 84B1 (.1) Potri.009G008100 [exp] 42 / 1e-05 AT2G28080 622 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.007G140500 [exp] 42 / 2e-05 AT2G43840 463 / 3e-161 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040590 pacid=23157580 polypeptide=Lus10040590 locus=Lus10040590.g ID=Lus10040590.BGIv1.0 annot-version=v1.0 ATGGCAGCGGCAGCAGCCCAACAGCAGCGACAGCCACATGTGGTGATGGCAACATTCCCAGCACAAGGCCATATGAATCCCAGCGTTCATTTCTCCATCC AGCTAGTACTCCTCGGATGCCGTGTCACTCTCCTCACCACCGTCTCCGGAAGACTCCTTATTACCAAGTCCAACATCCTCCTCCCACCTGGACTGTCCGT CGTAACATTCTCTGATGGTTACGACGTGGCGGGGTCTTCTTGGAAGACCAAAACAAGCAGTGGGAGCAGTTGA
AA sequence Show only first row Show all	>Lus10040590 pacid=23157580 polypeptide=Lus10040590 locus=Lus10040590.g ID=Lus10040590.BGIv1.0 annot-version=v1.0 MAAAAAQQQRQPHVVMATFPAQGHMNPSVHFSIQLVLLGCRVTLLTTVSGRLLITKSNILLPPGLSVVTFSDGYDVAGSSWKTKTSSGSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05560		UGT75B1, UGT1	UDP-GLUCOSE TRANSFERASE 1, UDP...		Lus10040590 [exp]	0	1
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10010841 [exp]	2.8	0.9551
AT3G08030			Protein of unknown function, D...		Lus10039602 [exp]	4.0	0.9507
AT3G58120	bZIP	ATBZIP61	Basic-leucine zipper (bZIP) tr...		Lus10039902 [exp]	6.9	0.9482
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Lus10014356 [exp]	8.8	0.9329
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10031470 [exp]	11.2	0.9441
AT2G18300	bHLH	bHLH064, HBI1	basic helix-loop-helix (bHLH) ...		Lus10026008 [exp]	12.4	0.9399
AT3G59090			unknown protein		Lus10004930 [exp]	14.7	0.9042
AT4G14090			UDP-Glycosyltransferase superf...		Lus10040591 [exp]	18.3	0.9295
AT1G33260			Protein kinase superfamily pro...		Lus10016382 [exp]	19.4	0.9052
AT3G58120	bZIP	ATBZIP61	Basic-leucine zipper (bZIP) tr...		Lus10002185 [exp]	19.8	0.9323

Compare expression of checked genes

Lus10040590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.