Lus10040591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14090 184 / 3e-56 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05560 181 / 4e-55 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
AT4G15550 181 / 8e-55 IAGLU indole-3-acetate beta-D-glucosyltransferase (.1)
AT1G05530 169 / 2e-50 UGT75B2, UGT2 UDP-GLUCOSYL TRANSFERASE 2, UDP-glucosyl transferase 75B2 (.1)
AT1G24100 152 / 4e-44 UGT74B1 UDP-glucosyl transferase 74B1 (.1)
AT1G05680 148 / 1e-42 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT2G31790 147 / 2e-42 UDP-Glycosyltransferase superfamily protein (.1)
AT1G05675 146 / 6e-42 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31750 143 / 9e-41 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT2G43840 138 / 6e-39 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021610 352 / 1e-121 AT1G05560 372 / 6e-125 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
Lus10019989 301 / 4e-101 AT4G15550 379 / 5e-127 indole-3-acetate beta-D-glucosyltransferase (.1)
Lus10015515 295 / 8e-99 AT4G15550 379 / 3e-127 indole-3-acetate beta-D-glucosyltransferase (.1)
Lus10008742 166 / 4e-49 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10006351 158 / 1e-47 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10024486 158 / 3e-46 AT1G05680 389 / 4e-132 Uridine diphosphate glycosyltransferase 74E2 (.1)
Lus10006721 155 / 2e-45 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10039041 154 / 1e-44 AT1G05675 343 / 3e-114 UDP-Glycosyltransferase superfamily protein (.1)
Lus10024118 153 / 2e-44 AT1G05675 375 / 2e-126 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G055600 208 / 2e-65 AT4G15550 442 / 2e-152 indole-3-acetate beta-D-glucosyltransferase (.1)
Potri.002G236500 201 / 1e-62 AT4G15550 436 / 3e-150 indole-3-acetate beta-D-glucosyltransferase (.1)
Potri.017G101800 198 / 1e-61 AT4G14090 369 / 3e-124 UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G052500 198 / 2e-61 AT4G15550 419 / 3e-143 indole-3-acetate beta-D-glucosyltransferase (.1)
Potri.002G236400 196 / 9e-61 AT1G05560 442 / 1e-152 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1)
Potri.014G146000 194 / 6e-60 AT4G15550 429 / 2e-147 indole-3-acetate beta-D-glucosyltransferase (.1)
Potri.004G083700 193 / 3e-59 AT4G14090 374 / 3e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G389200 166 / 3e-49 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.015G071900 161 / 1e-47 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1)
Potri.014G175000 157 / 9e-46 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10040591 pacid=23157831 polypeptide=Lus10040591 locus=Lus10040591.g ID=Lus10040591.BGIv1.0 annot-version=v1.0
ATGGCAGTAATATCGAAGAAGCAAAGGGAAGAGTTGGCAAAAGGACTAGTGAGTAGTAACAGACCGTTTTTGTGGGTGATAAGAAAAGATGAATCAGTGG
AGAAAGAAGAAGAGAGGATTGAGATGGTGCGATGGAGAGAGGAGATGGAGACCAAGGCAGAGAGTGTCGGTGGGAAAATAGTTGAATGGTGCTCGCAGGT
GGAGGTGCTTCCACATGAAGCAGTAGGATGTTTTGTAACGCACTGCGGATGGAACTCGACGCTAGAGAGCATATGTTTGGGAGTACCACTGGTGGCTTTC
CCGCAATTTTCGGATCAAACCACGAATGCGAAGATGGTAGAGGCTGTGTGGAAGATAGGGGTGAGGGTGGTAGTGCCTGACCAGAAACCTGAAACAGGGG
AGGTGGCGGTCGTGGTGGAGGGTGATGAGATAAGGAGATGTTTGGATTTGGTGATGGGAGAAGGCCAGGTTAGGGAACAGGTTAGGACAAATGCAAATAA
GTGGAAGCAACTTGCTAGAGACGCGTTGCGAGAAGGTGGATCTTCGCATTCCAATATCAAAGCTTTTGTCGACCAAATTATCGGTAAACGATTGTAG
AA sequence
>Lus10040591 pacid=23157831 polypeptide=Lus10040591 locus=Lus10040591.g ID=Lus10040591.BGIv1.0 annot-version=v1.0
MAVISKKQREELAKGLVSSNRPFLWVIRKDESVEKEEERIEMVRWREEMETKAESVGGKIVEWCSQVEVLPHEAVGCFVTHCGWNSTLESICLGVPLVAF
PQFSDQTTNAKMVEAVWKIGVRVVVPDQKPETGEVAVVVEGDEIRRCLDLVMGEGQVREQVRTNANKWKQLARDALREGGSSHSNIKAFVDQIIGKRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14090 UDP-Glycosyltransferase superf... Lus10040591 0 1
AT4G14550 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic... Lus10018766 3.3 0.9612
AT5G03960 IQD12 IQ-domain 12 (.1) Lus10018031 6.0 0.9528
AT3G61640 AGP20, ATAGP20 arabinogalactan protein 20 (.1... Lus10033939 7.2 0.9547
AT4G31470 CAP (Cysteine-rich secretory p... Lus10013693 9.4 0.9520
AT3G24450 Heavy metal transport/detoxifi... Lus10017730 11.5 0.9498
AT3G25070 RIN4 RPM1 interacting protein 4 (.1... Lus10006451 13.0 0.9277
AT5G15140 Galactose mutarotase-like supe... Lus10005251 13.4 0.9451
AT1G06930 unknown protein Lus10009096 13.8 0.9172
AT5G39050 PMAT1 phenolic glucoside malonyltran... Lus10029797 15.3 0.8729
AT4G02330 AtPME41, ATPMEP... pectin methylesterase 41, Plan... Lus10031470 15.6 0.9447

Lus10040591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.