Lus10040605 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39910 107 / 1e-27 Pectin lyase-like superfamily protein (.1)
AT5G27530 100 / 1e-24 Pectin lyase-like superfamily protein (.1)
AT4G35670 98 / 7e-24 Pectin lyase-like superfamily protein (.1)
AT5G14650 94 / 2e-22 Pectin lyase-like superfamily protein (.1)
AT3G15720 94 / 3e-22 Pectin lyase-like superfamily protein (.1.2)
AT5G44840 90 / 5e-21 Pectin lyase-like superfamily protein (.1)
AT5G17200 87 / 1e-19 Pectin lyase-like superfamily protein (.1)
AT1G78400 86 / 2e-19 Pectin lyase-like superfamily protein (.1)
AT1G60590 86 / 2e-19 Pectin lyase-like superfamily protein (.1)
AT1G05650 81 / 8e-18 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040610 184 / 7e-56 AT5G17200 346 / 7e-116 Pectin lyase-like superfamily protein (.1)
Lus10002727 124 / 2e-33 AT3G15720 254 / 9e-81 Pectin lyase-like superfamily protein (.1.2)
Lus10016940 107 / 4e-27 AT5G17200 320 / 6e-106 Pectin lyase-like superfamily protein (.1)
Lus10032875 87 / 5e-20 AT3G15720 342 / 3e-114 Pectin lyase-like superfamily protein (.1.2)
Lus10036035 86 / 1e-19 AT3G15720 339 / 3e-114 Pectin lyase-like superfamily protein (.1.2)
Lus10002124 84 / 7e-19 AT2G43870 505 / 7e-180 Pectin lyase-like superfamily protein (.1)
Lus10029121 82 / 4e-18 AT3G26610 566 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10014826 82 / 5e-18 AT5G17200 301 / 1e-97 Pectin lyase-like superfamily protein (.1)
Lus10022530 81 / 1e-17 AT2G43870 471 / 4e-166 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G252900 105 / 1e-26 AT5G44840 297 / 3e-98 Pectin lyase-like superfamily protein (.1)
Potri.012G119700 104 / 4e-26 AT5G17200 356 / 1e-120 Pectin lyase-like superfamily protein (.1)
Potri.018G028700 100 / 2e-24 AT5G27530 362 / 2e-121 Pectin lyase-like superfamily protein (.1)
Potri.001G346800 97 / 2e-23 AT5G14650 506 / 5e-178 Pectin lyase-like superfamily protein (.1)
Potri.015G088600 91 / 3e-21 AT1G70500 323 / 1e-106 Pectin lyase-like superfamily protein (.1)
Potri.010G042100 90 / 9e-21 AT1G60590 675 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.007G144100 85 / 4e-19 AT2G43870 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G006200 84 / 1e-18 AT3G59850 503 / 7e-178 Pectin lyase-like superfamily protein (.1)
Potri.007G144400 81 / 1e-17 AT3G59850 476 / 2e-168 Pectin lyase-like superfamily protein (.1)
Potri.007G144500 80 / 1e-17 AT3G59850 493 / 3e-175 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10040605 pacid=23157671 polypeptide=Lus10040605 locus=Lus10040605.g ID=Lus10040605.BGIv1.0 annot-version=v1.0
ATGGCGGGTCTAGTAGCACTAATCGCCAACCTTCTGGTTCTCTTACTGACCTCTCAAGCTTGCCTCTCCTATCGTCCCTTGGAAGAAAACAACCATTACT
ATGGAACAATGGACGATGCCAGAAGGTACATCGACGGCTTTCTCGACTACTTAGCATCCGCTAGAGACGACAGCCGGTTGATGACTTCGACACCAAGCCA
TATTCGTGACGAAACTTTCGGCTATGGCTCCGCTGGAAGCTTCAACGTGCTCGATTATGGCGCTGTTGGAGACGGCCGCACTGATTCGTCCGCTGCTTTC
TCGAAAGCATGGGGTGATTTCTGTGGAGCGAGTGGACAACCGACTCTGATTATACCTTCCGGTAATGTGTTCTTGCTCAACCCAATTTCTTTCACGGGTC
CTTGCAATTCTCAGAAGCTTCGAATTCAGTTGCAAGGGACACTCCTGGCACCATCGAGCATCAACGCTTGGAGAAACAGCAAAGACGATTGGATTCAATT
CTCTTACGTGAATGGTCTAACAATCAACGGCGGAGGTAAAATCGACGGTAGGGATGGCATTCGGGTACATCGGGTCCGAATATATATCCCCCGAAACCCG
GCCCGTAACCTATCCGGGTATTGGAATTCATGCCCGGATTATCAGAACGGGTAA
AA sequence
>Lus10040605 pacid=23157671 polypeptide=Lus10040605 locus=Lus10040605.g ID=Lus10040605.BGIv1.0 annot-version=v1.0
MAGLVALIANLLVLLLTSQACLSYRPLEENNHYYGTMDDARRYIDGFLDYLASARDDSRLMTSTPSHIRDETFGYGSAGSFNVLDYGAVGDGRTDSSAAF
SKAWGDFCGASGQPTLIIPSGNVFLLNPISFTGPCNSQKLRIQLQGTLLAPSSINAWRNSKDDWIQFSYVNGLTINGGGKIDGRDGIRVHRVRIYIPRNP
ARNLSGYWNSCPDYQNG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39910 Pectin lyase-like superfamily ... Lus10040605 0 1

Lus10040605 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.