Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51325 70 / 3e-16 RING/U-box superfamily protein (.1) AT4G11680 65 / 6e-13 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT5G08139 60 / 3e-11 RING/U-box superfamily protein (.1) AT2G01735 57 / 3e-10 RIE1 RING-finger protein for embryogenesis (.1) AT1G68070 57 / 4e-10 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT1G12760 56 / 7e-10 Zinc finger, C3HC4 type (RING finger) family protein (.1), Zinc finger, C3HC4 type (RING finger) family protein (.2) AT1G63170 55 / 2e-09 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT5G02750 54 / 3e-09 SGR9 SHOOT GRAVITROPISM 9, RING/U-box superfamily protein (.1) AT5G45290 54 / 4e-09 RING/U-box superfamily protein (.1.2) AT5G41400 53 / 4e-09 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018292 [exp] 263 / 1e-91 AT3G51325 74 / 3e-18 RING/U-box superfamily protein (.1) Lus10021801 [exp] 59 / 1e-10 AT1G68070 478 / 1e-169 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10034587 [exp] 59 / 1e-10 AT1G68070 489 / 6e-172 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10012819 [exp] 58 / 1e-10 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1) Lus10001568 [exp] 57 / 3e-10 AT3G55530 361 / 9e-127 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1) Lus10029582 [exp] 55 / 3e-09 AT3G61180 315 / 3e-106 RING/U-box superfamily protein (.1) Lus10030464 [exp] 54 / 4e-09 AT1G26800 181 / 3e-57 RING/U-box superfamily protein (.1) Lus10004977 [exp] 54 / 6e-09 AT3G55530 371 / 1e-130 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1) Lus10020258 [exp] 54 / 7e-09 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G109600 [exp] 101 / 2e-28 AT3G51325 62 / 3e-13 RING/U-box superfamily protein (.1) Potri.014G075000 [exp] 66 / 2e-13 AT3G61180 315 / 1e-105 RING/U-box superfamily protein (.1) Potri.002G155200 [exp] 61 / 2e-11 AT3G61180 366 / 3e-125 RING/U-box superfamily protein (.1) Potri.004G122000 [exp] 58 / 2e-11 AT1G26800 94 / 1e-24 RING/U-box superfamily protein (.1) Potri.003G123300 [exp] 57 / 4e-10 AT1G12760 400 / 7e-138 Zinc finger, C3HC4 type (RING finger) family protein (.1), Zinc finger, C3HC4 type (RING finger) family protein (.2) Potri.010G168300 [exp] 56 / 4e-10 AT1G26800 195 / 4e-63 RING/U-box superfamily protein (.1) Potri.008G134900 [exp] 56 / 9e-10 AT1G68070 392 / 2e-136 Zinc finger, C3HC4 type (RING finger) family protein (.1) Potri.001G127100 [exp] 56 / 1e-09 AT5G45290 286 / 2e-89 RING/U-box superfamily protein (.1.2) Potri.008G125700 [exp] 54 / 1e-09 AT2G01150 125 / 5e-37 RING-H2 finger protein 2B (.1) Potri.010G106300 [exp] 55 / 2e-09 AT1G68070 412 / 2e-144 Zinc finger, C3HC4 type (RING finger) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF00097 [flax] [poplar] zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Lus10040617 pacid=23157603 polypeptide=Lus10040617 locus=Lus10040617.g ID=Lus10040617.BGIv1.0 annot-version=v1.0 ATGATGATACTAAGCAAACTGGCATCTCTTATCTGCAACTCCATCATTGGTCTCAAAAGCCAGCAAAGCATCTTGAAAAATGCGGCAAGTCCCAGTCCAA GGTCCACATTTTGGAACGTGCTGAAGAGCATCAAGGAAGGATTAATGAGCAGCTCATCACAAGAGGTTCCTTACGAAGAAGCAGAGAGTCATGATGATGG TGGTGAGTGTTGCTGCTGCATCTGCTTGATGCAGATGGAGATTGGTGGTGGATCTGATTTGGAGATGCTTCCTTGCCAGCATAAGTTCCACAAGGTTTGT ATAGAGAGGTGGCTTATGAGGAAGAGGAGGAGGACTTGTCCACTCTGCCGATTTTCGATGGTGGAAGATGAAGATGAAGAAGTGCAAGAGTACCTGACAG AGGAGATGCTCATTTGGTTTTCTTCCTTTCATGTTGCTGGCTTTTAG
AA sequence Show only first row Show all	>Lus10040617 pacid=23157603 polypeptide=Lus10040617 locus=Lus10040617.g ID=Lus10040617.BGIv1.0 annot-version=v1.0 MMILSKLASLICNSIIGLKSQQSILKNAASPSPRSTFWNVLKSIKEGLMSSSSQEVPYEEAESHDDGGECCCCICLMQMEIGGGSDLEMLPCQHKFHKVC IERWLMRKRRRTCPLCRFSMVEDEDEEVQEYLTEEMLIWFSSFHVAGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51325			RING/U-box superfamily protein...		Lus10040617 [exp]	0	1
AT3G51325			RING/U-box superfamily protein...		Lus10018292 [exp]	2.0	0.9839
AT2G41610			unknown protein		Lus10030172 [exp]	3.5	0.9811
AT1G27440		ATGUT1, IRX10, ...	Exostosin family protein (.1)		Lus10043326 [exp]	4.2	0.9825
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Lus10035517 [exp]	4.9	0.9825
AT4G08850			Leucine-rich repeat receptor-l...		Lus10008229 [exp]	6.0	0.9695
AT3G52480			unknown protein		Lus10029407 [exp]	8.3	0.9630
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Lus10020890 [exp]	8.7	0.9799
AT3G42950			Pectin lyase-like superfamily ...		Lus10027646 [exp]	10.1	0.9765
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Lus10041106 [exp]	11.2	0.9752
AT1G27440		ATGUT1, IRX10, ...	Exostosin family protein (.1)		Lus10019479 [exp]	11.2	0.9761

Compare expression of checked genes

Lus10040617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.