Lus10040623 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45120 140 / 1e-39 Eukaryotic aspartyl protease family protein (.1)
AT5G10080 50 / 1e-07 Eukaryotic aspartyl protease family protein (.1)
AT4G35880 50 / 3e-07 Eukaryotic aspartyl protease family protein (.1)
AT1G66180 46 / 3e-06 Eukaryotic aspartyl protease family protein (.1)
AT3G42550 45 / 7e-06 Eukaryotic aspartyl protease family protein (.1)
AT3G02740 45 / 7e-06 Eukaryotic aspartyl protease family protein (.1)
AT2G28010 45 / 1e-05 Eukaryotic aspartyl protease family protein (.1)
AT2G28030 45 / 1e-05 Eukaryotic aspartyl protease family protein (.1)
AT3G51350 45 / 1e-05 Eukaryotic aspartyl protease family protein (.1)
AT3G52500 44 / 1e-05 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018286 251 / 4e-82 AT5G45120 520 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10000725 58 / 4e-10 AT4G16563 508 / 2e-177 Eukaryotic aspartyl protease family protein (.1)
Lus10008513 54 / 1e-08 AT4G16563 493 / 7e-172 Eukaryotic aspartyl protease family protein (.1)
Lus10007466 51 / 9e-08 AT4G16563 523 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10005212 50 / 1e-07 AT3G52500 145 / 2e-40 Eukaryotic aspartyl protease family protein (.1)
Lus10028941 50 / 2e-07 AT4G16563 489 / 2e-169 Eukaryotic aspartyl protease family protein (.1)
Lus10020201 50 / 3e-07 AT5G36260 550 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10027001 50 / 3e-07 AT5G36260 546 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10013325 49 / 3e-07 AT3G52500 159 / 2e-45 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G118000 122 / 3e-33 AT5G45120 575 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.015G113100 119 / 8e-32 AT5G45120 588 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.003G076300 57 / 1e-09 AT4G16563 484 / 2e-168 Eukaryotic aspartyl protease family protein (.1)
Potri.001G158600 56 / 2e-09 AT4G16563 494 / 5e-172 Eukaryotic aspartyl protease family protein (.1)
Potri.003G105300 52 / 4e-08 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1)
Potri.016G071900 51 / 1e-07 AT3G52500 491 / 8e-172 Eukaryotic aspartyl protease family protein (.1)
Potri.002G092100 50 / 1e-07 AT5G10080 474 / 3e-163 Eukaryotic aspartyl protease family protein (.1)
Potri.005G079900 49 / 5e-07 AT5G10080 538 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.007G063800 49 / 6e-07 AT4G35880 696 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.006G204700 48 / 8e-07 AT3G52500 504 / 5e-177 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0129 Peptidase_AA PF00026 Asp Eukaryotic aspartyl protease
Representative CDS sequence
>Lus10040623 pacid=23157661 polypeptide=Lus10040623 locus=Lus10040623.g ID=Lus10040623.BGIv1.0 annot-version=v1.0
ATGGCTTCTCTCATCATCATCATCATCATCATCATCACAACCTTCTTCCTACTCCTCAATGCCTTCACATTTTTATCAATCCATTCCCAAAATACCCCTC
CAACCTCACTTATTCTACGCCTCACCCTCTCCAAAACCTCCCTCCCACCACCCAAAAAACAACACAAAACTACATCCATTTCATCCACCCAAACGACGTC
GTCGAGCACAATAACGGCGCCGTTGAGAGGAGTCCGAGACGGATACCTCATCCCTTTAAACCTAGGCACTCCACCTCAGCAGGTCCAAGTCTACCTGGAC
ACAGGCAGCGACCTCACCTGGGTCCCATGTGGCAACCTCACGTTTGACTGCATTGACTGCGACGACTACTACAAGTCAACCCTTGCTCCCAAATCCTTAG
GCAGCTTCACTCCTTCACTCTCCTCCACCTCCTATCGAGACACGTGCGGCAGCCGGTTCTGTTCCCATGTCCACAGCTCCCTCGATCTTTGCATTGTCTC
CGGCTGCTCGTTGACCACCGTCGTTTAA
AA sequence
>Lus10040623 pacid=23157661 polypeptide=Lus10040623 locus=Lus10040623.g ID=Lus10040623.BGIv1.0 annot-version=v1.0
MASLIIIIIIIITTFFLLLNAFTFLSIHSQNTPPTSLILRLTLSKTSLPPPKKQHKTTSISSTQTTSSSTITAPLRGVRDGYLIPLNLGTPPQQVQVYLD
TGSDLTWVPCGNLTFDCIDCDDYYKSTLAPKSLGSFTPSLSSTSYRDTCGSRFCSHVHSSLDLCIVSGCSLTTVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45120 Eukaryotic aspartyl protease f... Lus10040623 0 1
AT5G12060 Plant self-incompatibility pro... Lus10023195 5.3 0.8432
AT5G17600 RING/U-box superfamily protein... Lus10008458 7.5 0.8432
AT4G10850 SWEET7, AtSWEET... Nodulin MtN3 family protein (.... Lus10023047 9.2 0.8432
AT4G35610 C2H2ZnF zinc finger (C2H2 type) family... Lus10035994 10.8 0.8414
AT5G07480 KUOX1 KAR-UP oxidoreductase 1 (.1) Lus10043000 11.8 0.8413
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10030505 13.2 0.8404
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10023022 14.2 0.8391
AT1G76810 eukaryotic translation initiat... Lus10023474 15.0 0.8388
AT5G54010 UDP-Glycosyltransferase superf... Lus10008453 15.9 0.8386
AT3G24060 Plant self-incompatibility pro... Lus10017719 16.7 0.8333

Lus10040623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.