Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80245 117 / 7e-35 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3) AT4G00695 110 / 2e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018276 [exp] 209 / 2e-68 AT3G02910 142 / 4e-41 AIG2-like (avirulence induced gene) family protein (.1) Lus10042425 [exp] 188 / 4e-63 AT1G80245 108 / 2e-31 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3) Lus10018344 [exp] 158 / 1e-51 AT1G80245 86 / 5e-23 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3) Lus10026245 [exp] 122 / 3e-37 ND 48 / 3e-08
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G149100 [exp] 121 / 2e-36 AT1G80245 91 / 3e-24 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3) Potri.001G081300 [exp] 106 / 1e-30 AT1G80245 80 / 5e-20 Spc97 / Spc98 family of spindle pole body (SBP) component (.1), Spc97 / Spc98 family of spindle pole body (SBP) component (.2), Spc97 / Spc98 family of spindle pole body (SBP) component (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040637 pacid=23157900 polypeptide=Lus10040637 locus=Lus10040637.g ID=Lus10040637.BGIv1.0 annot-version=v1.0 ATGGATAACGTAAACAAGCTTATAGAGAACAGCAGCATTGAAGACGTACAGTGGCTTTGTTCCCTGTCCGAGTCTGAGCTTGACGTCCTGATCAGCTTAA AGAAGCTGGTGATTCGGCGGGCAAAAGCTATTGGTCACGAAGAACTGGCCGATAAATTTGACCTGAAGTTGCTCCGAGCACTTGGACTAGTTGTCATGGA GCATTTCAGAAACAAGGTGAAGGGTTTGCCACCAATACCTGGCATGGACAAGTCCACTGCGAATATAGATGGTTGCAACTTACTAAAGTCTAAGCTTGGG GATAACTTAAGCATTGAAGAGTTGAAGTCTCGTCTTAAAAGACCAAGTAAAAGGTAG
AA sequence Show only first row Show all	>Lus10040637 pacid=23157900 polypeptide=Lus10040637 locus=Lus10040637.g ID=Lus10040637.BGIv1.0 annot-version=v1.0 MDNVNKLIENSSIEDVQWLCSLSESELDVLISLKKLVIRRAKAIGHEELADKFDLKLLRALGLVVMEHFRNKVKGLPPIPGMDKSTANIDGCNLLKSKLG DNLSIEELKSRLKRPSKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80245			Spc97 / Spc98 family of spindl...		Lus10040637 [exp]	0	1
AT1G45110			Tetrapyrrole (Corrin/Porphyrin...		Lus10024288 [exp]	7.2	0.7908
AT1G14930			Polyketide cyclase/dehydrase a...		Lus10042490 [exp]	7.3	0.8049
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10040148 [exp]	11.0	0.6821
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10042095 [exp]	17.8	0.7730
AT3G16210			F-box family protein (.1)		Lus10031512 [exp]	19.5	0.7276
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002244 [exp]	23.7	0.7476
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	25.0	0.7453
AT3G58140			phenylalanyl-tRNA synthetase c...		Lus10028547 [exp]	27.9	0.6835
AT3G57930			unknown protein		Lus10031806 [exp]	29.1	0.7716
AT2G40435			unknown protein		Lus10017415 [exp]	32.6	0.7541

Compare expression of checked genes

Lus10040637 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.