Lus10040641 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07200 45 / 2e-06 RING/U-box superfamily protein (.1.2)
AT2G26350 42 / 4e-05 PEX10, ATPEX10 peroxin 10 (.1)
AT1G18660 39 / 0.0005 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4)
AT5G48655 39 / 0.0006 RING/U-box superfamily protein (.1.2.3)
AT1G74990 38 / 0.0007 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018271 191 / 1e-63 AT3G07200 51 / 2e-08 RING/U-box superfamily protein (.1.2)
Lus10022569 48 / 3e-07 AT3G07200 81 / 3e-19 RING/U-box superfamily protein (.1.2)
Lus10022774 47 / 6e-07 AT5G48655 153 / 7e-47 RING/U-box superfamily protein (.1.2.3)
Lus10020007 44 / 8e-06 AT2G26350 449 / 2e-158 peroxin 10 (.1)
Lus10010791 41 / 0.0001 AT1G19310 266 / 1e-90 RING/U-box superfamily protein (.1)
Lus10016303 41 / 0.0001 AT1G19310 268 / 2e-91 RING/U-box superfamily protein (.1)
Lus10019075 39 / 0.0006 AT1G18660 583 / 0.0 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4)
Lus10022492 38 / 0.0009 AT2G23780 241 / 1e-80 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G082200 49 / 1e-07 AT3G07200 86 / 2e-20 RING/U-box superfamily protein (.1.2)
Potri.003G148300 47 / 4e-07 AT5G48655 77 / 6e-17 RING/U-box superfamily protein (.1.2.3)
Potri.014G191400 43 / 2e-05 AT5G48655 158 / 8e-49 RING/U-box superfamily protein (.1.2.3)
Potri.006G222000 42 / 3e-05 AT2G26350 519 / 0.0 peroxin 10 (.1)
Potri.002G245500 42 / 3e-05 AT5G48655 154 / 2e-47 RING/U-box superfamily protein (.1.2.3)
Potri.014G040400 40 / 0.0001 AT1G19310 226 / 4e-75 RING/U-box superfamily protein (.1)
Potri.002G133000 40 / 0.0002 AT1G19310 244 / 5e-82 RING/U-box superfamily protein (.1)
Potri.007G031600 39 / 0.0003 AT2G23780 227 / 4e-75 RING/U-box superfamily protein (.1)
Potri.005G127900 39 / 0.0005 AT2G23780 234 / 3e-78 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence
>Lus10040641 pacid=23157823 polypeptide=Lus10040641 locus=Lus10040641.g ID=Lus10040641.BGIv1.0 annot-version=v1.0
ATGAGTACTCCCCCACCGAGTCCAACCAATGCTCACAATTGCTCGCCTGAGCAGGAAACCCACAATGGTGGAGGTGGTGATGCTAGTACTGATCGTGTTA
TTGGTGAAGCTGCAGAGATACTGCACAACTTTGGTACTGCAGCTGCTGGTGATCATCGTGGTGTAGCGCCTGTTGTTGCTGAACCAGATGATGATGTGGT
GGAAGTGAATGCTGCTGATCATCAAGTGGGGGCTGGTGTACAGAGGTTAAGGTGTGCGATATGCAGGGGGGAGAGGGTGAGGGATCCGACGGCGACGATG
TGCGGACATGTGTTCTGCAGGATCTGCATTCTGAATGCTCTCAACTGGAATAGGATGTACCCGACTTGCAGGGCACCTATCCGCCGCGGCGAACGTGCCC
TTTTGAGGATCTACCTCTCCTAG
AA sequence
>Lus10040641 pacid=23157823 polypeptide=Lus10040641 locus=Lus10040641.g ID=Lus10040641.BGIv1.0 annot-version=v1.0
MSTPPPSPTNAHNCSPEQETHNGGGGDASTDRVIGEAAEILHNFGTAAAGDHRGVAPVVAEPDDDVVEVNAADHQVGAGVQRLRCAICRGERVRDPTATM
CGHVFCRICILNALNWNRMYPTCRAPIRRGERALLRIYLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07200 RING/U-box superfamily protein... Lus10040641 0 1
AT1G77860 KOM KOMPEITO, Rhomboid-related int... Lus10003743 4.0 0.8736
AT1G78580 ATTPS1 TREHALOSE-6-PHOSPHATE SYNTHASE... Lus10005412 6.5 0.8109
Lus10000528 11.2 0.7808
AT2G45570 CYP76C2 "cytochrome P450, family 76, s... Lus10040353 22.5 0.7834
AT2G41660 MIZ1 mizu-kussei 1, Protein of unkn... Lus10035443 87.3 0.7126
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10000793 94.5 0.7642
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10000993 102.8 0.7805
AT5G18080 SAUR24 small auxin up RNA 24, SAUR-li... Lus10039962 109.8 0.7431
AT2G32235 unknown protein Lus10008093 170.4 0.7198
AT3G45070 P-loop containing nucleoside t... Lus10033716 228.9 0.7224

Lus10040641 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.