Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31335 45 / 8e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018270 [exp] 137 / 2e-39 AT2G40540 652 / 0.0 potassium transporter 2 (.1.2) Lus10038328 [exp] 60 / 1e-13 AT1G31335 64 / 2e-15 unknown protein Lus10036190 [exp] 58 / 7e-13 AT1G31335 67 / 1e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G148100 [exp] 62 / 2e-14 AT1G31335 37 / 8e-05 unknown protein Potri.001G082332 [exp] 59 / 3e-13 AT1G31335 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040642 pacid=23157592 polypeptide=Lus10040642 locus=Lus10040642.g ID=Lus10040642.BGIv1.0 annot-version=v1.0 ATGGAGTTGATAGTGGTGATATCGCTGCCGCTGATAGTGTTCTTCCTTCTGGTGGGGGCAGCATGCTACTTCTATGGACGATCCAAACGCAGAAACCGCA ACCTTCCCGATCATCAGGTCTTCGGAGTTCCTGCTCCTCCGCCTTCCACTCATGTTCCTCTTCATCCTTCCTCTCCTCCCGCCAAGCATGCCAACTCCTC CCATGTCTGA
AA sequence Show only first row Show all	>Lus10040642 pacid=23157592 polypeptide=Lus10040642 locus=Lus10040642.g ID=Lus10040642.BGIv1.0 annot-version=v1.0 MELIVVISLPLIVFFLLVGAACYFYGRSKRRNRNLPDHQVFGVPAPPPSTHVPLHPSSPPAKHANSSHV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31335			unknown protein		Lus10040642 [exp]	0	1
					Lus10025868 [exp]	2.8	0.9494
AT1G53540			HSP20-like chaperones superfam...		Lus10017202 [exp]	3.7	0.9462
AT1G19715			Mannose-binding lectin superfa...		Lus10024290 [exp]	4.2	0.9450
AT4G27290			S-locus lectin protein kinase ...		Lus10016862 [exp]	6.0	0.9430
AT5G46530			AWPM-19-like family protein (....		Lus10004587 [exp]	7.1	0.9436
AT1G23530			unknown protein		Lus10030608 [exp]	9.2	0.9445
AT5G27690			Heavy metal transport/detoxifi...		Lus10020906 [exp]	10.4	0.9381
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Lus10013552 [exp]	10.6	0.9382
					Lus10038232 [exp]	11.2	0.9420
					Lus10033847 [exp]	12.0	0.9341

Compare expression of checked genes

Lus10040642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.