Lus10040643 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16510 90 / 2e-23 SAUR-like auxin-responsive protein family (.1)
AT1G56150 85 / 8e-22 SAUR-like auxin-responsive protein family (.1)
AT3G12830 84 / 2e-21 SAUR-like auxin-responsive protein family (.1)
AT1G79130 82 / 1e-20 SAUR-like auxin-responsive protein family (.1)
AT3G61900 61 / 1e-12 SAUR-like auxin-responsive protein family (.1)
AT4G31320 61 / 9e-12 SAUR-like auxin-responsive protein family (.1)
AT2G24400 57 / 1e-10 SAUR-like auxin-responsive protein family (.1)
AT2G46690 55 / 2e-10 SAUR-like auxin-responsive protein family (.1)
AT4G34760 55 / 2e-10 SAUR-like auxin-responsive protein family (.1)
AT4G22620 55 / 4e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018269 258 / 5e-89 AT1G16510 92 / 4e-24 SAUR-like auxin-responsive protein family (.1)
Lus10031754 82 / 3e-20 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1)
Lus10031178 74 / 4e-17 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026977 61 / 7e-12 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10001397 54 / 6e-10 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10012190 54 / 2e-09 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10042374 53 / 2e-09 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10026297 53 / 4e-09 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10035716 53 / 8e-09 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G096400 83 / 5e-21 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1)
Potri.007G067800 79 / 2e-19 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 68 / 1e-14 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.002G057500 57 / 2e-11 AT3G12830 64 / 2e-14 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 54 / 6e-10 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.002G000600 54 / 9e-10 AT1G43040 113 / 2e-33 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 55 / 1e-09 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 54 / 2e-09 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 51 / 5e-09 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 52 / 6e-09 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10040643 pacid=23157626 polypeptide=Lus10040643 locus=Lus10040643.g ID=Lus10040643.BGIv1.0 annot-version=v1.0
ATGAAGAAACTGTTCCGGACCCTCTCCGACAAGGTCCGTAAAATCAGCACCGGAAGAATGAGCTCCTCAGACCGGGTCGGCGGCTACTCCGTCCTTCGCC
GTACCAGCTCTGATTCCGAGCTCCGGCGAAGGAGGATGAGGGGTAAGAACAAACTGGCCCAACTGCTGCAGATGAGGCTCGGCAAGAAGAGATCGGTGGT
GACAGTCCCGGCGGGTCATTTCCCGGTTCAGGTAGGGACCGATGAGGAGGCGGCGGAGACGTTTATGGTCAGCGCGAAGCTGCTAAGGCACCCGGCGTTT
GTGAACCTGCTGAAGATATCGGCGGCGGAGTTTGGGTATGGGCAGAGCGGCGTGCTGAGGATCCCGGTTCGGGTGATGGTTTTCCAGCGGGTTATGGAGC
TGATTCGGGTGACCAAGGACCCAGCTGGAGTGGTTGATTGGGACGATGATTTCAACTCAATGATTAACTAG
AA sequence
>Lus10040643 pacid=23157626 polypeptide=Lus10040643 locus=Lus10040643.g ID=Lus10040643.BGIv1.0 annot-version=v1.0
MKKLFRTLSDKVRKISTGRMSSSDRVGGYSVLRRTSSDSELRRRRMRGKNKLAQLLQMRLGKKRSVVTVPAGHFPVQVGTDEEAAETFMVSAKLLRHPAF
VNLLKISAAEFGYGQSGVLRIPVRVMVFQRVMELIRVTKDPAGVVDWDDDFNSMIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16510 SAUR-like auxin-responsive pro... Lus10040643 0 1
AT1G21690 RFC4, EMB1968 replication factor C 4, embryo... Lus10028543 7.5 0.7729
AT5G56110 MYB MS188, ATMYB80,... MALE STERILE 188, ARABIDOPSIS ... Lus10008353 12.6 0.7672
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Lus10033646 15.2 0.7628
AT1G68730 Zim17-type zinc finger protein... Lus10019154 19.1 0.7631
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10019871 20.2 0.7636
AT3G59110 Protein kinase superfamily pro... Lus10006544 30.1 0.7481
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014043 32.3 0.7581
Lus10041470 37.2 0.6625
AT3G23255 unknown protein Lus10011825 38.6 0.7619
AT3G48210 unknown protein Lus10042089 49.9 0.7353

Lus10040643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.