Lus10040652 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17810 365 / 1e-128 BETA-TIP beta-tonoplast intrinsic protein (.1)
AT1G73190 359 / 3e-126 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
AT4G01470 266 / 8e-90 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1)
AT2G36830 263 / 2e-88 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
AT3G26520 256 / 1e-85 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1)
AT3G16240 231 / 2e-76 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1)
AT5G47450 213 / 4e-69 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1)
AT2G25810 210 / 8e-68 TIP4;1 tonoplast intrinsic protein 4;1 (.1)
AT4G17340 204 / 2e-65 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1)
AT3G47440 162 / 7e-49 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018256 468 / 1e-169 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1)
Lus10036187 432 / 5e-155 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
Lus10038324 430 / 2e-154 AT1G73190 380 / 1e-134 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
Lus10021510 268 / 9e-91 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Lus10022611 267 / 3e-90 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Lus10005885 265 / 2e-89 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1)
Lus10023913 265 / 3e-89 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Lus10014411 263 / 1e-88 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Lus10040863 260 / 1e-87 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G154800 404 / 4e-144 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1)
Potri.018G152100 396 / 4e-141 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1)
Potri.010G209900 276 / 9e-94 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1)
Potri.008G050700 268 / 1e-90 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1)
Potri.006G121700 262 / 4e-88 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Potri.016G098200 259 / 5e-87 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Potri.004G216500 254 / 5e-85 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1)
Potri.009G005400 253 / 7e-85 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Potri.009G027200 249 / 2e-83 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1)
Potri.001G235300 246 / 4e-82 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00230 MIP Major intrinsic protein
Representative CDS sequence
>Lus10040652 pacid=23157821 polypeptide=Lus10040652 locus=Lus10040652.g ID=Lus10040652.BGIv1.0 annot-version=v1.0
ATGCCTAGAAGATACGGATTTGGGAGAGCGGAAGAGGCCACCCACCCTGATTCCTTCAGAGCTACTCTAGCTGAACTCGTTTCTACTTTCATCTTTGTCT
TTGCTGGGGAAGGCTCCGGTCTTGCTCTTGACAAGCTGTACCAGGAAACAGGCCCCCCTGCTTCTGGACTGGTGATGATTGCACTTGCGCATGCACTAGC
ACTCTTCGCCGCAGTAGCATCCAGCATCAACGTCTCCGGTGGACATGTCAATCCAGCTATCACCTTTGCTGCTCTTCTTGGAGGAAGGATTTCGGTCGTC
CGAGCCATATATTACTGGATTGCTCAGCTTCTCGGCTCCATCGTCGCCTCCCTCTTGCTCCGCCTTGTCACCAACGGGATGAGGCCGGTCGGGTTCTACG
TGCACTCCGAAGTGAGCGAGGTGGAAGGATTGATACTCGAAATCGCGCTGACGTTCGGGCTAGTTTACACGGTTTACGCGACTGCAATCGATCCCAAGAG
AGGGAGCATCGGGATCATGGCGCCCCTGGCGATCGGGTTGATCGTCGGGGCAAACATCTTGGTCGGAGGGCCGTTCGATGGTGCAGCAATGAATCCAGCC
AGAGCATTCGGGCCAACATTGGTCGGGTGGAGATGGAAGAACCACTGGATCTACTGGTTGGGTCCTTTCCTTGGTGCGGGTTTGGCAGCGATTGTTTACG
AGTTCTTGGTTATCCCCACTGAGCCAACAATTCATACCCATCATCAGCCTTTGGCTCCTGAAGACTACTAA
AA sequence
>Lus10040652 pacid=23157821 polypeptide=Lus10040652 locus=Lus10040652.g ID=Lus10040652.BGIv1.0 annot-version=v1.0
MPRRYGFGRAEEATHPDSFRATLAELVSTFIFVFAGEGSGLALDKLYQETGPPASGLVMIALAHALALFAAVASSINVSGGHVNPAITFAALLGGRISVV
RAIYYWIAQLLGSIVASLLLRLVTNGMRPVGFYVHSEVSEVEGLILEIALTFGLVYTVYATAIDPKRGSIGIMAPLAIGLIVGANILVGGPFDGAAMNPA
RAFGPTLVGWRWKNHWIYWLGPFLGAGLAAIVYEFLVIPTEPTIHTHHQPLAPEDY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10040652 0 1
AT2G29040 Exostosin family protein (.1) Lus10016532 3.5 0.8983
AT4G17905 ATL4H RING/U-box superfamily protein... Lus10025338 6.4 0.8699
AT4G35700 C2H2ZnF DAZ3 DUO1-activated zinc finger 3, ... Lus10041659 6.4 0.9165
AT3G45280 ATSYP72, SYP72 syntaxin of plants 72 (.1) Lus10036118 7.4 0.8365
Lus10020135 8.9 0.7481
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10008212 9.5 0.9023
AT1G71140 MATE efflux family protein (.1... Lus10008911 10.0 0.8489
AT3G07200 RING/U-box superfamily protein... Lus10018271 13.3 0.7048
Lus10039965 15.0 0.8939
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10010474 15.2 0.7547

Lus10040652 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.