Lus10040670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58740 216 / 2e-73 HSP20-like chaperones superfamily protein (.1)
AT5G53400 68 / 3e-14 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones superfamily protein (.1)
AT4G27890 62 / 2e-12 HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018234 263 / 9e-92 AT5G58740 266 / 8e-93 HSP20-like chaperones superfamily protein (.1)
Lus10019028 72 / 6e-16 AT5G53400 324 / 3e-111 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10005009 72 / 1e-15 AT5G53400 306 / 2e-103 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10018250 69 / 4e-15 AT5G53400 213 / 4e-69 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10040656 68 / 8e-15 AT5G53400 216 / 3e-70 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Lus10027048 40 / 5e-05 AT4G27890 68 / 3e-15 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G251204 209 / 1e-70 AT5G58740 298 / 1e-105 HSP20-like chaperones superfamily protein (.1)
Potri.009G046000 82 / 2e-21 AT5G58740 97 / 2e-27 HSP20-like chaperones superfamily protein (.1)
Potri.015G013900 80 / 1e-18 AT5G53400 283 / 8e-95 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.012G014100 77 / 1e-17 AT5G53400 277 / 4e-93 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.003G100900 63 / 1e-12 AT5G53400 232 / 2e-75 BOBBER1, HSP20-like chaperones superfamily protein (.1)
Potri.001G132500 61 / 6e-12 AT5G53400 225 / 1e-73 BOBBER1, HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF04969 CS CS domain
Representative CDS sequence
>Lus10040670 pacid=23157770 polypeptide=Lus10040670 locus=Lus10040670.g ID=Lus10040670.BGIv1.0 annot-version=v1.0
ATGGCAGAGAAACTGGCTCCAGAGAAGCGCCACAGCTTCCTCCACAACGGTAAAAAGGTGTTCGAATGGGATCAAACCCTAGACGAGGTTAACTTGTACA
TAGATAGACCGACGGGAATCCGTCCGCAGCAATTTCACTGCGTGATTGGGTCTAGTCATCTCACAATCGGCATCAAAGGCAGCCCTCCTTATCTCGATCA
TGACCTAGCTCATCCAGTTAAGACTGACTGTTCTTTCTGGACCTTAGAGGATGATATAATGCACATTACGCTACAAAAGAGGGATAAGGGGCAGACGTGG
CCTTCGCCCCTTAAGGGTGATGCTCAGCTGGATCCTCTCTCGGCTGATCTCGAGCAGAAACGTCTTATGCTCCAGAGATTTCAGGAAGAGGCAAGGCTCA
AATGCTAG
AA sequence
>Lus10040670 pacid=23157770 polypeptide=Lus10040670 locus=Lus10040670.g ID=Lus10040670.BGIv1.0 annot-version=v1.0
MAEKLAPEKRHSFLHNGKKVFEWDQTLDEVNLYIDRPTGIRPQQFHCVIGSSHLTIGIKGSPPYLDHDLAHPVKTDCSFWTLEDDIMHITLQKRDKGQTW
PSPLKGDAQLDPLSADLEQKRLMLQRFQEEARLKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58740 HSP20-like chaperones superfam... Lus10040670 0 1
AT5G35080 unknown protein Lus10039972 5.4 0.8596
AT5G06830 unknown protein Lus10012023 12.6 0.8568
AT5G07840 PIA1 phytochrome interacting ankyri... Lus10018958 15.1 0.8484
Lus10009045 18.3 0.8046
AT1G48840 Plant protein of unknown funct... Lus10020973 23.9 0.8396
AT4G19860 alpha/beta-Hydrolases superfam... Lus10018310 24.1 0.8534
AT1G26580 unknown protein Lus10026655 24.5 0.8233
AT2G42780 unknown protein Lus10031380 25.8 0.8430
AT1G25682 Family of unknown function (DU... Lus10041495 29.6 0.8396
AT2G01350 QPT quinolinate phoshoribosyltrans... Lus10018781 30.1 0.8508

Lus10040670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.