Lus10040681 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29700 230 / 3e-79 ATPH1 pleckstrin homologue 1 (.1)
AT5G05710 220 / 3e-75 Pleckstrin homology (PH) domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018222 236 / 5e-80 AT2G29700 190 / 1e-61 pleckstrin homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G044500 258 / 3e-90 AT2G29700 234 / 1e-80 pleckstrin homologue 1 (.1)
Potri.001G250400 255 / 5e-89 AT2G29700 229 / 1e-78 pleckstrin homologue 1 (.1)
Potri.008G066700 221 / 3e-75 AT5G05710 239 / 2e-82 Pleckstrin homology (PH) domain superfamily protein (.1)
Potri.010G190500 211 / 1e-71 AT5G05710 232 / 1e-79 Pleckstrin homology (PH) domain superfamily protein (.1)
Potri.009G011200 41 / 0.0001 AT2G28320 1071 / 0.0 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0266 PH PF00169 PH PH domain
Representative CDS sequence
>Lus10040681 pacid=23157805 polypeptide=Lus10040681 locus=Lus10040681.g ID=Lus10040681.BGIv1.0 annot-version=v1.0
ATGGAATCCCTCCTCCGAAGCATAACCCGGCAGGACCCGAACCCAGAGGACTACACCGACATCGACTTCTGGACCAACCCGGAGCGATCCGGGTGGCTCA
CCAAGCAAGGCGAGTACATCCGCACCTGGAGGCGCCGCTGGTTCATCCTCAAGCAAGGGAAGCTCCTCTGGTTCAAGGACAGCATCGTCACCCGCGGCTC
CGTCCCTCGCGGAGTCGTCGCCGTCGGCCAGTGCCTCACTGTCAAGGGCGCCGAGGACGTCCTCAACAAGCCTTTCGCCTTCGAGCTCTCCACCAATAAC
GACACCATGTACTTCATCGCCGATTCCGAGAAGGAGAAGGAAGAGTGGATCAACTCGATCGGGAGGTCGATCGTGCAGCACTCCAGGTCCGTCACCGATT
CCGAAGTCGTCGATTACGACAGCACCAGGCGGTGA
AA sequence
>Lus10040681 pacid=23157805 polypeptide=Lus10040681 locus=Lus10040681.g ID=Lus10040681.BGIv1.0 annot-version=v1.0
MESLLRSITRQDPNPEDYTDIDFWTNPERSGWLTKQGEYIRTWRRRWFILKQGKLLWFKDSIVTRGSVPRGVVAVGQCLTVKGAEDVLNKPFAFELSTNN
DTMYFIADSEKEKEEWINSIGRSIVQHSRSVTDSEVVDYDSTRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G29700 ATPH1 pleckstrin homologue 1 (.1) Lus10040681 0 1
AT1G55365 unknown protein Lus10010316 1.4 0.8418
AT1G16840 unknown protein Lus10035733 1.7 0.8505
AT5G65200 ATPUB38 ARABIDOPSIS THALIANA PLANT U-B... Lus10043464 3.5 0.8226
AT3G18280 Bifunctional inhibitor/lipid-t... Lus10017616 4.2 0.8409
AT1G26920 unknown protein Lus10037195 5.7 0.8189
AT2G39705 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 ... Lus10024323 8.9 0.8376
AT4G16400 unknown protein Lus10016614 11.8 0.7991
AT4G00550 DGD2 digalactosyl diacylglycerol de... Lus10040927 12.3 0.7952
AT5G19590 Protein of unknown function, D... Lus10033088 14.7 0.7744
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10013434 20.4 0.8352

Lus10040681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.