Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20140 67 / 7e-15 SOUL heme-binding family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013345 [exp] 79 / 5e-19 AT5G20140 464 / 8e-164 SOUL heme-binding family protein (.1.2) Lus10001847 [exp] 77 / 3e-18 AT5G20140 330 / 3e-111 SOUL heme-binding family protein (.1.2) Lus10019445 [exp] 66 / 2e-14 AT5G20140 422 / 3e-148 SOUL heme-binding family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G073501 [exp] 66 / 1e-14 AT5G20140 528 / 0.0 SOUL heme-binding family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [flax] [poplar] NTF2 PF10184 [flax] [poplar] DUF2358 Uncharacterized conserved protein (DUF2358)
Representative CDS sequence Show only first row Show all	>Lus10040682 pacid=23157730 polypeptide=Lus10040682 locus=Lus10040682.g ID=Lus10040682.BGIv1.0 annot-version=v1.0 ATGATGAACAAAGTATGGGAAGGCGTCCCTGTTCTAGATGCTACATTCGAAGGCGGCAGAAACGAAGCATCCTATGACGAGCGCCTCCGGTTTCATGATC CAATTACTCGATACGACGACATCAATTGGTATCTGTTGAACATCGCTGCTTTGAAGATTCTGTTCAACCCTAAGTTCCAGCTCCATTGGGTCAAAAAGGT TTCTGCATCTGCTCTTCTGATTGCTCTGTAG
AA sequence Show only first row Show all	>Lus10040682 pacid=23157730 polypeptide=Lus10040682 locus=Lus10040682.g ID=Lus10040682.BGIv1.0 annot-version=v1.0 MMNKVWEGVPVLDATFEGGRNEASYDERLRFHDPITRYDDINWYLLNIAALKILFNPKFQLHWVKKVSASALLIAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G20140			SOUL heme-binding family prote...		Lus10040682 [exp]	0	1
AT4G14103			F-box/RNI-like superfamily pro...		Lus10017218 [exp]	1.0	0.8190
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10009775 [exp]	6.3	0.7218
AT5G43400			Uncharacterised conserved prot...		Lus10016990 [exp]	7.7	0.6875
					Lus10021139 [exp]	9.2	0.7807
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016498 [exp]	13.0	0.6983
AT1G16760			Protein kinase protein with ad...		Lus10033340 [exp]	13.4	0.7594
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10013395 [exp]	14.1	0.7779
					Lus10031183 [exp]	16.4	0.7522
AT3G61780		EMB1703	embryo defective 1703 (.1)		Lus10030250 [exp]	16.8	0.4971
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Lus10030546 [exp]	18.2	0.7496

Compare expression of checked genes

Lus10040682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.