Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47070 41 / 9e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018216 [exp] 65 / 2e-14 AT3G47070 67 / 3e-15 unknown protein Lus10005866 [exp] 42 / 5e-06 AT3G47070 73 / 3e-18 unknown protein Lus10001204 [exp] 42 / 5e-06 AT3G47070 73 / 3e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G043600 [exp] 49 / 6e-09 AT3G47070 68 / 2e-16 unknown protein Potri.001G249600 [exp] 47 / 5e-08 AT3G47070 49 / 8e-09 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11493 [flax] [poplar] TSP9 Thylakoid soluble phosphoprotein TSP9
Representative CDS sequence Show only first row Show all	>Lus10040689 pacid=23157635 polypeptide=Lus10040689 locus=Lus10040689.g ID=Lus10040689.BGIv1.0 annot-version=v1.0 ATGGCTTCCCTTCCGATTTCGTTCACTACAGCAGCTCGAGTGTTCGCAGCCACAGCAGCCAAAGGATCAGGAGGGAGCAAAGAAGAGAAGGGACCTTGGG ATTGGATCGTCGGAACCTTAATCAAGGAAGATCAGTTCTACGAGACCGACCCAATTCTCAACAAGACCGAGGAGAAGAGCGGCGGTGGACCAACTTCCGG CCGAGGAACAACTTCAGGCCGCGGAACAACTTCCGGCCGGAAAGGCACCACCACCGTCTCCGTTCCCCAGAAGAAGAAGGGCGGCTTTGGTGGCCTCTTC GCCAAGAACTGA
AA sequence Show only first row Show all	>Lus10040689 pacid=23157635 polypeptide=Lus10040689 locus=Lus10040689.g ID=Lus10040689.BGIv1.0 annot-version=v1.0 MASLPISFTTAARVFAATAAKGSGGSKEEKGPWDWIVGTLIKEDQFYETDPILNKTEEKSGGGPTSGRGTTSGRGTTSGRKGTTTVSVPQKKKGGFGGLF AKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47070			unknown protein		Lus10040689 [exp]	0	1
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Lus10032504 [exp]	1.4	0.9485
AT3G47070			unknown protein		Lus10018216 [exp]	1.4	0.9545
AT4G00895			ATPase, F1 complex, OSCP/delta...		Lus10012618 [exp]	2.4	0.9410
AT2G05620		PGR5	proton gradient regulation 5 (...		Lus10011777 [exp]	4.0	0.9385
AT1G06040	CO	BBX24, STO	SALT TOLERANCE, B-box domain p...		Lus10027041 [exp]	5.2	0.9166
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10030336 [exp]	6.3	0.8928
AT5G24930	CO	COL4, ATCOL4	CONSTANS-like 4 (.1)		Lus10026238 [exp]	6.3	0.9294
AT3G21890	CO		B-box type zinc finger family ...		Lus10031583 [exp]	6.9	0.9190
AT5G16010			3-oxo-5-alpha-steroid 4-dehydr...		Lus10008951 [exp]	7.7	0.9204
AT4G16490			ARM repeat superfamily protein...		Lus10017562 [exp]	9.5	0.9084

Compare expression of checked genes

Lus10040689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.