Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018215 [exp] 139 / 9e-44 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G249500 [exp] 48 / 6e-08 AT1G07300 49 / 2e-08 josephin protein-related (.1) Potri.009G043501 [exp] 47 / 1e-07 AT1G07300 / josephin protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040690 pacid=23157857 polypeptide=Lus10040690 locus=Lus10040690.g ID=Lus10040690.BGIv1.0 annot-version=v1.0 ATGATTACGAGGAGCAAAAGCAAAGGAAGTCATCACAATATGCCAACACCATCCATCAGTGGAGGAAGAGGAGGATCCGGGTTGCTTCGATGTTTGAGGT TCGGCAGTCTGCGAAAGAGGTCGTCGTTAATGGAGATTCAGCAGCCTGTTGGAAATAATGGTTTGAAGGATCCTAGTGATAAGATGGCTAAAGCACTGTG CTTCAAGTGTAGAAGTACATGCCGGGTTTCTTCATCCTCTGCGGGCGGATCCAGGTCTCTGTATGGCGTGTCTCCGTTTGATGTTCATAGGAAAGAGGCC ATAAAGGAGTGTATTGAGTTCATCAACCACTCCTCTTCTCTGCCTCGATCCAACTCTGTCTCTGCTGCTTAA
AA sequence Show only first row Show all	>Lus10040690 pacid=23157857 polypeptide=Lus10040690 locus=Lus10040690.g ID=Lus10040690.BGIv1.0 annot-version=v1.0 MITRSKSKGSHHNMPTPSISGGRGGSGLLRCLRFGSLRKRSSLMEIQQPVGNNGLKDPSDKMAKALCFKCRSTCRVSSSSAGGSRSLYGVSPFDVHRKEA IKECIEFINHSSSLPRSNSVSAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040690 [exp]	0	1
					Lus10018215 [exp]	1.4	0.9184
AT4G19460			UDP-Glycosyltransferase superf...		Lus10033297 [exp]	1.7	0.9010
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10019227 [exp]	2.2	0.8946
AT1G27040			Major facilitator superfamily ...		Lus10002793 [exp]	2.8	0.9055
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10015421 [exp]	4.5	0.8954
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014402 [exp]	5.2	0.8742
AT2G40330		RCAR9, PYL6	regulatory components of ABA r...		Lus10007275 [exp]	5.5	0.8884
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Lus10030484 [exp]	6.3	0.8779
AT5G64667		IDL2	inflorescence deficient in abs...		Lus10005811 [exp]	8.8	0.8328
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10028791 [exp]	9.2	0.8854

Compare expression of checked genes

Lus10040690 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.