Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58960 249 / 2e-82 GIL1 GRAVITROPIC IN THE LIGHT, Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) AT2G45260 143 / 7e-42 Plant protein of unknown function (DUF641) (.1) AT1G29300 120 / 5e-33 UNE1 unfertilized embryo sac 1, Plant protein of unknown function (DUF641) (.1) AT3G14870 117 / 1e-31 Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) AT3G60680 113 / 3e-30 Plant protein of unknown function (DUF641) (.1) AT1G53380 103 / 1e-26 Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) AT2G30380 52 / 1e-08 Plant protein of unknown function (DUF641) (.1) AT1G12330 45 / 4e-06 unknown protein AT5G12900 42 / 7e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016444 [exp] 289 / 2e-96 AT5G58960 635 / 0.0 GRAVITROPIC IN THE LIGHT, Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) Lus10030291 [exp] 145 / 2e-42 AT2G45260 668 / 0.0 Plant protein of unknown function (DUF641) (.1) Lus10001989 [exp] 144 / 3e-42 AT2G45260 671 / 0.0 Plant protein of unknown function (DUF641) (.1) Lus10009923 [exp] 116 / 2e-31 AT2G45260 275 / 2e-88 Plant protein of unknown function (DUF641) (.1) Lus10024190 [exp] 115 / 5e-31 AT2G45260 270 / 1e-86 Plant protein of unknown function (DUF641) (.1) Lus10008587 [exp] 108 / 1e-28 AT2G45260 266 / 1e-84 Plant protein of unknown function (DUF641) (.1) Lus10007312 [exp] 107 / 5e-28 AT1G29300 433 / 2e-149 unfertilized embryo sac 1, Plant protein of unknown function (DUF641) (.1) Lus10009284 [exp] 106 / 2e-27 AT3G60680 541 / 0.0 Plant protein of unknown function (DUF641) (.1) Lus10029259 [exp] 105 / 2e-27 AT1G29300 419 / 6e-144 unfertilized embryo sac 1, Plant protein of unknown function (DUF641) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G041000 [exp] 256 / 1e-83 AT5G58960 466 / 2e-159 GRAVITROPIC IN THE LIGHT, Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) Potri.002G145900 [exp] 146 / 5e-43 AT2G45260 692 / 0.0 Plant protein of unknown function (DUF641) (.1) Potri.002G145000 [exp] 123 / 6e-34 AT3G60680 494 / 4e-172 Plant protein of unknown function (DUF641) (.1) Potri.014G066600 [exp] 117 / 8e-32 AT3G60680 522 / 0.0 Plant protein of unknown function (DUF641) (.1) Potri.011G108000 [exp] 115 / 6e-31 AT1G53380 531 / 0.0 Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) Potri.013G155400 [exp] 113 / 2e-30 AT2G45260 300 / 4e-98 Plant protein of unknown function (DUF641) (.1) Potri.001G387700 [exp] 112 / 5e-30 AT1G53380 524 / 0.0 Plant protein of unknown function (DUF641) (.1), Plant protein of unknown function (DUF641) (.2), Plant protein of unknown function (DUF641) (.3) Potri.004G061600 [exp] 107 / 4e-28 AT1G29300 485 / 6e-170 unfertilized embryo sac 1, Plant protein of unknown function (DUF641) (.1) Potri.011G071000 [exp] 106 / 9e-28 AT1G29300 483 / 3e-169 unfertilized embryo sac 1, Plant protein of unknown function (DUF641) (.1) Potri.014G067600 [exp] 95 / 4e-24 AT2G45260 462 / 3e-163 Plant protein of unknown function (DUF641) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040708 pacid=23157599 polypeptide=Lus10040708 locus=Lus10040708.g ID=Lus10040708.BGIv1.0 annot-version=v1.0 ATGGACCCGGTGGAGCTGCTAGGGATCCTGCCGACTTGCCATTTCGGAAAATTCTGCACCAAGAAATACCTGGCGATCGTGCACCCGAAGATGGAGGAAT CCTTGTTCGGTAACTTGGAGCAGCGGCAGCAGGTGGTGGCGGGAAGTCATCCGAGGAGCCAATTCTACGCTGAGTTTTTAGGATTGGCTAAGGCGATTTG GTTGCTTCATCTGCTGGCGTTCTCTCTGGATCCATCGCCGAGTCAGTTTGAAGCGAGCAGAGGAGCTGAGTTCCATGCTCTGTACATGGAAAGTGTGGTG AAGTTTTCTGGAGGTAGGATTCCTGCTGGTCAGGTCGTTGGTTTCCCCGTTTGCCCTGGGTTTAAGCTTGGAAATGGATCAATTGTCAAGGCTAGGGTTT ATCTTGTTCCCAGAACATAA
AA sequence Show only first row Show all	>Lus10040708 pacid=23157599 polypeptide=Lus10040708 locus=Lus10040708.g ID=Lus10040708.BGIv1.0 annot-version=v1.0 MDPVELLGILPTCHFGKFCTKKYLAIVHPKMEESLFGNLEQRQQVVAGSHPRSQFYAEFLGLAKAIWLLHLLAFSLDPSPSQFEASRGAEFHALYMESVV KFSGGRIPAGQVVGFPVCPGFKLGNGSIVKARVYLVPRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58960		GIL1	GRAVITROPIC IN THE LIGHT, Plan...		Lus10040708 [exp]	0	1
AT5G58960		GIL1	GRAVITROPIC IN THE LIGHT, Plan...		Lus10040707 [exp]	1.4	0.8812
AT4G36680			Tetratricopeptide repeat (TPR)...		Lus10041727 [exp]	5.2	0.7894
AT5G58960		GIL1	GRAVITROPIC IN THE LIGHT, Plan...		Lus10016444 [exp]	6.5	0.8624
AT2G32400		ATGLR3.7, GLR5	GLUTAMATE RECEPTOR 3.7, glutam...		Lus10039672 [exp]	7.1	0.7551
AT4G19840		AtPP2A-1, ATPP2...	phloem protein 2-A1 (.1)		Lus10018304 [exp]	7.5	0.8580
AT5G05340			Peroxidase superfamily protein...		Lus10009933 [exp]	8.0	0.8560
AT3G57670	C2H2ZnF	WIP2, NTT	WIP domain protein 2, NO TRANS...		Lus10031271 [exp]	11.5	0.8490
AT5G19040		ATIPT5	Arabidopsis thaliana ISOPENTEN...		Lus10004428 [exp]	11.7	0.8487
					Lus10041943 [exp]	12.7	0.8536
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10032169 [exp]	13.4	0.8540

Compare expression of checked genes

Lus10040708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.