Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29540 132 / 2e-41 ATRPAC14, ATRPC14 RNApolymerase 14 kDa subunit (.1.2.3) AT3G52090 55 / 6e-11 NRPE11, NRPD11, NRPB11, ATRPB13.6 DNA-directed RNA polymerase, RBP11-like (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016452 [exp] 219 / 8e-76 AT2G29540 131 / 9e-41 RNApolymerase 14 kDa subunit (.1.2.3) Lus10019715 [exp] 55 / 9e-10 AT3G08020 726 / 0.0 PHD finger family protein (.1) Lus10016404 [exp] 54 / 1e-09 AT3G08020 569 / 0.0 PHD finger family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G246600 [exp] 171 / 6e-57 AT2G29540 136 / 6e-43 RNApolymerase 14 kDa subunit (.1.2.3) Potri.009G070900 [exp] 53 / 3e-10 AT3G52090 219 / 2e-75 DNA-directed RNA polymerase, RBP11-like (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0509 [flax] [poplar] RBP11-like PF01193 [flax] [poplar] RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10040717 pacid=23157778 polypeptide=Lus10040717 locus=Lus10040717.g ID=Lus10040717.BGIv1.0 annot-version=v1.0 ATGGAGCACGGCTCTTTGAACGATCCAAGCAAGGCAACCTTCACTTTTGTTGACGAGGACCACACGCTTGCAAATGCTGTCAGATTCAGCTTGAATCAAG ATCCAAGGGTATCATTCTGTGGATACAGCATTCCTCATCCTTCTGATGCTCGAGTTAACATTAGAATCCAGACTACAGGTGCACCTGCACGAGAGGTATT GAAGGATGGATGTGACTATTTGATGCGAATGTGCCAGCATGTGAACAGCACTGTGGACAAGGCTGTTGCCGAATTTAGAGCGAAGAATCCCACAGAGATG GAAACAGACAGTGGTTCAGATTGA
AA sequence Show only first row Show all	>Lus10040717 pacid=23157778 polypeptide=Lus10040717 locus=Lus10040717.g ID=Lus10040717.BGIv1.0 annot-version=v1.0 MEHGSLNDPSKATFTFVDEDHTLANAVRFSLNQDPRVSFCGYSIPHPSDARVNIRIQTTGAPAREVLKDGCDYLMRMCQHVNSTVDKAVAEFRAKNPTEM ETDSGSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	0	1
AT1G16810			unknown protein		Lus10033383 [exp]	1.4	0.8801
AT3G22660			rRNA processing protein-relate...		Lus10036936 [exp]	2.4	0.8609
AT3G59990		MAP2B	methionine aminopeptidase 2B (...		Lus10010592 [exp]	4.0	0.8672
AT1G16000			unknown protein		Lus10011478 [exp]	4.8	0.8257
AT2G18400			ribosomal protein L6 family pr...		Lus10014306 [exp]	4.9	0.8414
AT1G26750			unknown protein		Lus10016383 [exp]	5.5	0.8439
AT3G23390			Zinc-binding ribosomal protein...		Lus10040983 [exp]	6.7	0.8669
AT5G11500			unknown protein		Lus10038625 [exp]	7.5	0.8575
AT2G43780			unknown protein		Lus10035718 [exp]	8.7	0.8290
AT4G39300			unknown protein		Lus10026340 [exp]	8.7	0.8232

Compare expression of checked genes

Lus10040717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.