Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29530 145 / 3e-47 TIM10 Tim10/DDP family zinc finger protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016453 [exp] 173 / 4e-58 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10017463 [exp] 39 / 4e-05 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10028819 [exp] 35 / 0.0006 AT3G46560 110 / 1e-33 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10037964 [exp] 35 / 0.0008 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 35 / 0.0008 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G039600 [exp] 154 / 8e-51 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3) Potri.001G246500 [exp] 151 / 1e-49 AT2G29530 139 / 6e-45 Tim10/DDP family zinc finger protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10040718 pacid=23157734 polypeptide=Lus10040718 locus=Lus10040718.g ID=Lus10040718.BGIv1.0 annot-version=v1.0 ATGGCTGCCAACAATAGCGAACTCCCTGCAGGCGTCACCAAAGAACAGGCCTTTGGCATGGCGGAGACAGAGATGGAGTACAGAGTAGAGTTGTTCAACA AGCTCAGTCAGACTTGTTTCAGCAAGTGTGTTGACAAAAGGTACAAGGAATCTGAGCTGAACATGGGTGAAAACAGCTGCATCGATCGCTGCGTTTCAAA ATATTGGCTGGTGAACGGTCTGGTAGGTCAGATGCTGAGCGCCGGTGGTCAGCGCCCCATGTGA
AA sequence Show only first row Show all	>Lus10040718 pacid=23157734 polypeptide=Lus10040718 locus=Lus10040718.g ID=Lus10040718.BGIv1.0 annot-version=v1.0 MAANNSELPAGVTKEQAFGMAETEMEYRVELFNKLSQTCFSKCVDKRYKESELNMGENSCIDRCVSKYWLVNGLVGQMLSAGGQRPM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10040718 [exp]	0	1
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10016453 [exp]	1.4	0.9066
					Lus10002220 [exp]	4.0	0.7875
AT3G56070		ROC2	rotamase cyclophilin 2 (.1.2)		Lus10042553 [exp]	9.5	0.8215
AT5G27700			Ribosomal protein S21e (.1)		Lus10031494 [exp]	9.6	0.8383
AT2G42710			Ribosomal protein L1p/L10e fam...		Lus10015809 [exp]	9.8	0.7920
AT2G44860			Ribosomal protein L24e family ...		Lus10009403 [exp]	13.4	0.7981
AT5G60670			Ribosomal protein L11 family p...		Lus10015085 [exp]	16.7	0.7955
AT3G10350			P-loop containing nucleoside t...		Lus10021449 [exp]	20.6	0.6970
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10021027 [exp]	22.2	0.8078
AT1G49510		EMB1273	embryo defective 1273 (.1)		Lus10027929 [exp]	24.1	0.7832

Compare expression of checked genes

Lus10040718 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.