Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55700 60 / 6e-12 UDP-Glycosyltransferase superfamily protein (.1) AT3G55710 59 / 2e-11 UDP-Glycosyltransferase superfamily protein (.1) AT3G11340 56 / 2e-10 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT5G59590 51 / 1e-08 UGT76E2 UDP-glucosyl transferase 76E2 (.1) AT3G46700 50 / 1e-08 UDP-Glycosyltransferase superfamily protein (.1) AT1G22340 50 / 2e-08 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22360 50 / 2e-08 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2) AT3G46690 49 / 4e-08 UDP-Glycosyltransferase superfamily protein (.1) AT1G22380 48 / 1e-07 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT3G46680 47 / 2e-07 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016459 [exp] 180 / 3e-56 AT5G59590 357 / 3e-119 UDP-glucosyl transferase 76E2 (.1) Lus10004671 [exp] 62 / 2e-12 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 57 / 1e-10 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040725 [exp] 55 / 6e-10 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1) Lus10016460 [exp] 54 / 1e-09 AT5G59590 400 / 2e-136 UDP-glucosyl transferase 76E2 (.1) Lus10040244 [exp] 52 / 3e-09 AT3G55700 169 / 3e-50 UDP-Glycosyltransferase superfamily protein (.1) Lus10037268 [exp] 52 / 6e-09 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10000993 [exp] 51 / 1e-08 AT1G22380 563 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10004674 [exp] 48 / 4e-08 AT3G55700 109 / 4e-29 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G195300 [exp] 57 / 1e-10 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.001G245900 [exp] 56 / 3e-10 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1) Potri.010G195500 [exp] 55 / 3e-10 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195600 [exp] 54 / 6e-10 AT3G55700 515 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.002G098400 [exp] 49 / 5e-08 AT1G22360 640 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G313000 [exp] 49 / 8e-08 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052166 [exp] 47 / 2e-07 AT1G22360 607 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052300 [exp] 47 / 2e-07 AT1G22360 603 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G312600 [exp] 45 / 1e-06 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 45 / 2e-06 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040724 pacid=23157630 polypeptide=Lus10040724 locus=Lus10040724.g ID=Lus10040724.BGIv1.0 annot-version=v1.0 ATGGGTTGGATATATTTTGTGGCAGGTGTGGGTAAGGAGATGGGGATTCCTAGCTTGGTTCTGAGGACGAGCTGTGCTGCTAATTTGTTGACGTACCATG TTTTCCCTCAGCTTCGTGAGAAAGGCCATCTTCCTGAGCAATATTCGACGTCGTCGGAGCTGGTGCCGGGACTCCCAAACATCCGATACAAAGACCTCCC ATCCTACACCACCAACTGGCCCATAGAAGCCCAACTAGACTTCATTGCCACAATTCGCCAGACCCGATCAGCCTCCGCCGTCATCTGA
AA sequence Show only first row Show all	>Lus10040724 pacid=23157630 polypeptide=Lus10040724 locus=Lus10040724.g ID=Lus10040724.BGIv1.0 annot-version=v1.0 MGWIYFVAGVGKEMGIPSLVLRTSCAANLLTYHVFPQLREKGHLPEQYSTSSELVPGLPNIRYKDLPSYTTNWPIEAQLDFIATIRQTRSASAVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040724 [exp]	0	1
					Lus10003774 [exp]	2.4	1.0000
					Lus10003695 [exp]	2.8	1.0000
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10005596 [exp]	3.0	1.0000
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10014436 [exp]	3.5	1.0000
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10015428 [exp]	3.9	1.0000
					Lus10033071 [exp]	4.2	1.0000
AT5G53820			Late embryogenesis abundant pr...		Lus10007566 [exp]	4.6	1.0000
					Lus10029489 [exp]	6.0	0.9558
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	8.0	1.0000
					Lus10039973 [exp]	8.0	0.8937

Compare expression of checked genes

Lus10040724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.