Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07410 374 / 1e-133 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 373 / 2e-133 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 368 / 2e-131 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT1G09630 339 / 1e-119 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT4G18800 295 / 2e-102 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT1G16920 293 / 1e-101 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 292 / 3e-101 AtRABA1f RAB GTPase homolog A1F (.1) AT5G45750 291 / 5e-101 AtRABA1c RAB GTPase homolog A1C (.1) AT1G06400 289 / 3e-100 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT4G18430 285 / 1e-98 AtRABA1e RAB GTPase homolog A1E (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016486 [exp] 416 / 4e-150 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10001026 [exp] 363 / 3e-129 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 360 / 3e-128 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 358 / 2e-127 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10041116 [exp] 325 / 2e-114 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10036441 [exp] 306 / 2e-106 AT1G09630 387 / 2e-138 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10029253 [exp] 299 / 5e-104 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 295 / 3e-102 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10015297 [exp] 295 / 3e-102 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G000300 [exp] 396 / 2e-142 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 388 / 3e-139 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 364 / 6e-130 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 360 / 3e-128 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.003G004100 [exp] 328 / 1e-115 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.011G070300 [exp] 308 / 1e-107 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 302 / 2e-105 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.001G374000 [exp] 294 / 3e-102 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 289 / 3e-100 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 289 / 4e-100 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10040745 pacid=23157760 polypeptide=Lus10040745 locus=Lus10040745.g ID=Lus10040745.BGIv1.0 annot-version=v1.0 ATGGCCCATAGGGTAGACCACGAGTATGATTACCTGTTCAAGATCGTGCTGATCGGAGACTCCGGAGTCGGCAAATCCAACATCCTCTCCAGGTTCACCC GAAATGAATTCTGCTTGGAGTCCAAATCCACTATCGGCGTCGAGTTCGCCACCAGAACTTTGCAGGTGGAAGGAAAGACTGTTAAGGCTCAGATTTGGGA CACAGCAGGGCAAGAGAGGTACCGAGCTATCACGAGTGCTTACTACAGGGGAGCGGTCGGTGCACTCCTAGTCTACGACATTACCAAGAGGCAGACTTTT GACAATGTCCAAAGGTGGCTACGCGAGTTGAGAGATCACGCCGATTCCAACATCGTCATAATGATGGCTGGCAACAAGTCCGACTTGAATCACCTGAGAG CTGTCTCTGAAGGAGATGGCCATTCCTTGGCTGAGAGGGAAGGGCTATCGTTCCTCGAGACTTCAGCACTCGAAGCTACAAACGTCGAGAAGGCTTTCCA GACCATACTGACTGAGATCTACCAGATCATAAGCAAAAAGGCTTTGGCTGCACAGGAAGCAGCTGCCAACTCTGCCATTCCTGGTCAAGGACCCACCATC AATGTCGCGGATAGCTCATCCAATGCGAAGAAAAGTTGCTGCTCTGGTTAA
AA sequence Show only first row Show all	>Lus10040745 pacid=23157760 polypeptide=Lus10040745 locus=Lus10040745.g ID=Lus10040745.BGIv1.0 annot-version=v1.0 MAHRVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF DNVQRWLRELRDHADSNIVIMMAGNKSDLNHLRAVSEGDGHSLAEREGLSFLETSALEATNVEKAFQTILTEIYQIISKKALAAQEAAANSAIPGQGPTI NVADSSSNAKKSCCSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040745 [exp]	0	1
AT4G33640			unknown protein		Lus10007087 [exp]	3.3	0.8833
AT4G17100			unknown protein		Lus10040133 [exp]	5.9	0.8443
AT4G16695			unknown protein		Lus10028968 [exp]	6.8	0.8224
AT5G14670		ATARFA1B	ADP-ribosylation factor A1B (....		Lus10030884 [exp]	7.7	0.8664
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10008615 [exp]	8.8	0.8515
AT2G45960		PIP1;2, ATHH2, ...	TRANSMEMBRANE PROTEIN A, NAMED...		Lus10032283 [exp]	11.7	0.8534
AT5G01710			methyltransferases (.1)		Lus10012217 [exp]	11.8	0.8515
AT4G36750			Quinone reductase family prote...		Lus10014325 [exp]	12.0	0.8126
AT5G24580			Heavy metal transport/detoxifi...		Lus10032923 [exp]	13.4	0.8321
AT3G62980		AtTIR1, TIR1	TRANSPORT INHIBITOR RESPONSE 1...		Lus10018425 [exp]	14.0	0.7946

Compare expression of checked genes

Lus10040745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.