Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59140 167 / 1e-55 BTB/POZ domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016485 [exp] 203 / 7e-70 AT5G59140 167 / 2e-55 BTB/POZ domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G037800 [exp] 194 / 3e-66 AT5G59140 166 / 4e-55 BTB/POZ domain-containing protein (.1) Potri.004G175900 [exp] 45 / 8e-07 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.009G135800 [exp] 40 / 3e-05 AT1G20140 215 / 9e-73 SKP1-like 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [flax] [poplar] POZ PF03931 [flax] [poplar] Skp1_POZ Skp1 family, tetramerisation domain
Representative CDS sequence Show only first row Show all	>Lus10040746 pacid=23157682 polypeptide=Lus10040746 locus=Lus10040746.g ID=Lus10040746.BGIv1.0 annot-version=v1.0 ATGAAGAAAGAAGACACAGTCAAGCTTATCAGCGCTGAAGGCTTCGAGTTCGTTATCCACAAGGAAGCCGCCATGGTTTCACAGACAATTCGCAACATGC TCACCTCTCCAGGGGGTTTCGCAGAGGCGCAACATGGGGAGGTGACTTTTCCTGAGATAAGCACCACCATTCTGGAGAAAATCTGCCAGTATTTCCATTG GTCTCTACAGTATGCTAGTGGTAAGGAAACAGAGTTCCCAATCGAACCTGAACTGACTCTGGAGCTTATGATGGCGGCTAATTACCTCCACACTTGA
AA sequence Show only first row Show all	>Lus10040746 pacid=23157682 polypeptide=Lus10040746 locus=Lus10040746.g ID=Lus10040746.BGIv1.0 annot-version=v1.0 MKKEDTVKLISAEGFEFVIHKEAAMVSQTIRNMLTSPGGFAEAQHGEVTFPEISTTILEKICQYFHWSLQYASGKETEFPIEPELTLELMMAANYLHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59140			BTB/POZ domain-containing prot...		Lus10040746 [exp]	0	1
AT1G10890			unknown protein		Lus10043141 [exp]	2.0	0.9131
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Lus10036164 [exp]	2.0	0.9156
AT5G43430		ETFBETA	electron transfer flavoprotein...		Lus10022185 [exp]	3.9	0.9142
AT4G12790			P-loop containing nucleoside t...		Lus10041086 [exp]	4.5	0.9188
AT1G03330			Small nuclear ribonucleoprotei...		Lus10042686 [exp]	5.0	0.9064
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10023016 [exp]	5.7	0.8660
AT5G04910			unknown protein		Lus10008941 [exp]	5.7	0.8795
AT4G17010			unknown protein		Lus10001160 [exp]	6.3	0.8960
AT4G32960			unknown protein		Lus10007456 [exp]	7.9	0.8976
AT1G59077			unknown protein		Lus10022089 [exp]	8.1	0.8760

Compare expression of checked genes

Lus10040746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.