Lus10040756 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46870 314 / 9e-109 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62350 159 / 2e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G09320 81 / 4e-17 VPS9B Vacuolar sorting protein 9 (VPS9) domain (.1)
AT3G27750 59 / 2e-10 EMB3123 EMBRYO DEFECTIVE 3123, unknown protein
AT4G39620 58 / 1e-09 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G13040 58 / 2e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G77340 58 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G17670 58 / 2e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G41170 57 / 3e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT4G20090 56 / 9e-09 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016476 452 / 3e-163 AT3G46870 346 / 3e-121 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000892 189 / 1e-59 AT1G62350 318 / 3e-111 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036049 187 / 5e-59 AT1G62350 316 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10043104 63 / 6e-11 AT3G16890 720 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1)
Lus10012328 62 / 7e-11 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 62 / 8e-11 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011849 61 / 2e-10 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036633 59 / 2e-10 AT4G39620 218 / 9e-69 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10028379 61 / 3e-10 AT2G17670 545 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G038200 340 / 6e-119 AT3G46870 326 / 2e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G275000 179 / 2e-55 AT1G62350 274 / 7e-94 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G134300 99 / 6e-25 AT5G09320 114 / 1e-28 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.009G169600 66 / 1e-12 AT5G09320 219 / 8e-67 Vacuolar sorting protein 9 (VPS9) domain (.1)
Potri.006G257300 64 / 1e-11 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G025600 63 / 4e-11 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G242500 62 / 5e-11 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G271200 62 / 6e-11 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G243600 62 / 6e-11 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G074500 62 / 1e-10 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10040756 pacid=23157780 polypeptide=Lus10040756 locus=Lus10040756.g ID=Lus10040756.BGIv1.0 annot-version=v1.0
ATGGCGATTCGCGCCTTTTCGAGGTCGAGAGTCTCCCGGACTGCCGTGGTTTCGTTCTTCCAGAACACACCGCACAATCCTACAAAACTAAATCCGGAAT
TTGTAGAGTCCCCGATACCATCATTAGACTCGAATGTTCCTACCAGCTCACTATCCGGGCTCAGGCAATACCACGATGGCCGACCCAGAGGACCTCTCTG
GAGAGGCAAGAAGCTGATAGGTAAAGAGGCGCTCTTTGTGGTTATGGGGTTAAAGCGCTTCAAGGACGAAGAGGAAAAGCTCGACAAGTTCATCAAAACG
CATGTTAACAGACTGCTGAAGGTGGACATGGTTGCTGTCGTCTGCGAGCTCGAGCGCCAAGACGAAGTTAGTCTGGCCGTTAAGATATTTCAAGTGATAC
AGAAGCAAGACTGGTACACGCCGGATCGCTATATTTACAAGGACCTGATAATTGCGTTAACGAAATCCAATAAAATGGATGAAGCAATGAAGCTGTGGCA
GTCTATGAGGGACGAGGGTCTTTTCCCGGATTCCCAAATGTACACTGAAGTCATCAGGGGTTTCTTGAGGGATGGATCCCCTGCTGATGCAATGAACGTG
TACGAAGACATGAAGGAATCCCCTGATCCTCCGGAGGAATTGCCGTTCAGGATTTTGTTGAAGGGCCTTCTTCCGCACCCTCTTTTGAGGAACAGAGTTA
AGCAAGACTACGAGGAGTTGTTTCCCGAGAAGAATGTCTTTGATCCTCCAGAAGAGATATTTGGCATGCACTGA
AA sequence
>Lus10040756 pacid=23157780 polypeptide=Lus10040756 locus=Lus10040756.g ID=Lus10040756.BGIv1.0 annot-version=v1.0
MAIRAFSRSRVSRTAVVSFFQNTPHNPTKLNPEFVESPIPSLDSNVPTSSLSGLRQYHDGRPRGPLWRGKKLIGKEALFVVMGLKRFKDEEEKLDKFIKT
HVNRLLKVDMVAVVCELERQDEVSLAVKIFQVIQKQDWYTPDRYIYKDLIIALTKSNKMDEAMKLWQSMRDEGLFPDSQMYTEVIRGFLRDGSPADAMNV
YEDMKESPDPPEELPFRILLKGLLPHPLLRNRVKQDYEELFPEKNVFDPPEEIFGMH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G46870 Pentatricopeptide repeat (PPR)... Lus10040756 0 1
AT1G69210 Uncharacterised protein family... Lus10026674 7.7 0.7922
AT5G25500 unknown protein Lus10002897 15.5 0.8033
AT4G35380 SEC7-like guanine nucleotide e... Lus10022975 16.7 0.7173
AT5G02050 Mitochondrial glycoprotein fam... Lus10012653 19.6 0.6998
AT4G26780 MGE2, AR192 mitochondrial GrpE 2, Co-chape... Lus10032565 26.0 0.7256
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10022692 38.6 0.7805
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10022378 39.5 0.7154
AT3G08000 RNA-binding (RRM/RBD/RNP motif... Lus10031534 41.3 0.7449
AT1G57540 unknown protein Lus10035345 41.7 0.7693
AT4G21720 unknown protein Lus10017512 53.3 0.6942

Lus10040756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.