Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09270 63 / 7e-13 ATGSTU8 glutathione S-transferase TAU 8 (.1) AT2G29420 61 / 5e-12 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) AT1G10360 56 / 2e-10 GST29, ATGSTU18 GLUTATHIONE S-TRANSFERASE 29, glutathione S-transferase TAU 18 (.1) AT2G29490 55 / 6e-10 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1) AT1G53680 54 / 2e-09 ATGSTU28 glutathione S-transferase TAU 28 (.1) AT1G78370 52 / 9e-09 ATGSTU20 glutathione S-transferase TAU 20 (.1) AT2G29470 52 / 1e-08 GST21, ATGSTU3 GLUTATHIONE S-TRANSFERASE 21, glutathione S-transferase tau 3 (.1) AT1G78340 50 / 6e-08 ATGSTU22 glutathione S-transferase TAU 22 (.1) AT2G29440 49 / 7e-08 GST24, ATGSTU6 GLUTATHIONE S-TRANSFERASE 24, glutathione S-transferase tau 6 (.1) AT2G29460 48 / 2e-07 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, glutathione S-transferase tau 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016471 [exp] 150 / 1e-46 AT2G29420 234 / 8e-78 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10040761 [exp] 128 / 6e-38 AT2G29420 233 / 1e-77 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016469 [exp] 120 / 8e-35 AT2G29420 230 / 2e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10040764 [exp] 114 / 2e-32 AT2G29420 229 / 6e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016470 [exp] 99 / 1e-26 AT2G29420 166 / 6e-52 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016467 [exp] 77 / 3e-18 AT2G29420 207 / 2e-67 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10021103 [exp] 64 / 2e-13 AT3G09270 250 / 1e-84 glutathione S-transferase TAU 8 (.1) Lus10017208 [exp] 64 / 4e-13 AT3G09270 212 / 3e-69 glutathione S-transferase TAU 8 (.1) Lus10040727 [exp] 62 / 2e-12 AT2G29420 216 / 6e-71 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G024200 [exp] 63 / 9e-13 AT2G29420 188 / 4e-60 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G070900 [exp] 61 / 3e-12 AT2G29420 221 / 9e-73 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.013G072400 [exp] 61 / 4e-12 AT3G09270 161 / 2e-49 glutathione S-transferase TAU 8 (.1) Potri.016G023340 [exp] 56 / 3e-10 AT2G29420 194 / 3e-62 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.016G023200 [exp] 55 / 6e-10 AT3G09270 189 / 1e-60 glutathione S-transferase TAU 8 (.1) Potri.010G061401 [exp] 53 / 1e-09 AT3G09270 113 / 7e-32 glutathione S-transferase TAU 8 (.1) Potri.010G061200 [exp] 52 / 5e-09 AT3G09270 202 / 8e-66 glutathione S-transferase TAU 8 (.1) Potri.011G140800 [exp] 52 / 6e-09 AT1G78380 318 / 1e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G436600 [exp] 52 / 9e-09 AT1G78380 318 / 2e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G431700 [exp] 51 / 1e-08 AT1G78380 307 / 4e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0497 [flax] [poplar] GST_C PF00043 [flax] [poplar] GST_C Glutathione S-transferase, C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10040763 pacid=23157925 polypeptide=Lus10040763 locus=Lus10040763.g ID=Lus10040763.BGIv1.0 annot-version=v1.0 ATGGGATGCTTTTTGCAGGTGTTGCTAACGGCGTTTAAGGCTTACATAGGGAAGGGGGACAAAGAACAAGAGGACGCGATCGAGGAATTCACACAGCAAG TGAAGTATCTGGAGGGGGAGCTGAACGGGAAGGAGTACTTCGGAGGGGAAAGGATCGGGTTTGTGGACATTGCAGTGTTCTCCATCTTGTACTGGCTTGG AGCGTTGGAGGAAGTTACGGAAGCAGATCTGTTGACCAAGGAGAAGTTCCCTGTATTGTTCAAATTGATGGAGAAGCTCCAAGATGATAACGATGTTGTG ATGGGGATGCCTGGCCTGCGAGGGACAAGCATCTGGATTACGTCCGAGCTGCTCGTGCTTTTCTATTGGAAGTTGTTGCTTCCAAAACAAATAGCTTAA
AA sequence Show only first row Show all	>Lus10040763 pacid=23157925 polypeptide=Lus10040763 locus=Lus10040763.g ID=Lus10040763.BGIv1.0 annot-version=v1.0 MGCFLQVLLTAFKAYIGKGDKEQEDAIEEFTQQVKYLEGELNGKEYFGGERIGFVDIAVFSILYWLGALEEVTEADLLTKEKFPVLFKLMEKLQDDNDVV MGMPGLRGTSIWITSELLVLFYWKLLLPKQIA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10040763 [exp]	0	1
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10040762 [exp]	1.0	0.8961
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10041993 [exp]	10.6	0.7423
AT1G05200		GLUR3, ATGLR3.4	glutamate receptor 3.4 (.1.2)		Lus10005276 [exp]	15.1	0.7838
AT1G13340			Regulator of Vps4 activity in ...		Lus10017591 [exp]	31.6	0.7099
AT2G43590			Chitinase family protein (.1)		Lus10032794 [exp]	34.1	0.7513
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031172 [exp]	41.0	0.6974
					Lus10026124 [exp]	42.1	0.6969
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Lus10008073 [exp]	51.8	0.6743
AT2G21950		SKIP6	SKP1 interacting partner 6 (.1...		Lus10030883 [exp]	56.5	0.6592
AT5G62280			Protein of unknown function (D...		Lus10031122 [exp]	58.8	0.7065

Compare expression of checked genes

Lus10040763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.