Lus10040765 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29420 115 / 6e-34 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
AT2G29440 110 / 9e-32 GST24, ATGSTU6 GLUTATHIONE S-TRANSFERASE 24, glutathione S-transferase tau 6 (.1)
AT2G29450 108 / 8e-31 ATGSTU1, AT103-1A, ATGSTU5 ARABIDOPSIS THALIANA GLUTATHIONE S-TRANSFERASE TAU 1, glutathione S-transferase tau 5 (.1)
AT2G29490 107 / 2e-30 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1)
AT2G29460 106 / 3e-30 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, glutathione S-transferase tau 4 (.1)
AT3G09270 105 / 6e-30 ATGSTU8 glutathione S-transferase TAU 8 (.1)
AT2G29480 103 / 5e-29 GST20, ATGSTU2 GLUTATHIONE S-TRANSFERASE 20, glutathione S-transferase tau 2 (.1)
AT5G62480 99 / 3e-27 GST14B, ATGSTU9 GLUTATHIONE S-TRANSFERASE 14B, GLUTATHIONE S-TRANSFERASE 14, glutathione S-transferase tau 9 (.1.2)
AT2G29470 99 / 4e-27 GST21, ATGSTU3 GLUTATHIONE S-TRANSFERASE 21, glutathione S-transferase tau 3 (.1)
AT1G74590 99 / 4e-27 ATGSTU10 glutathione S-transferase TAU 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016467 152 / 5e-48 AT2G29420 207 / 2e-67 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10040762 116 / 2e-35 AT2G29420 127 / 3e-38 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10016470 117 / 8e-35 AT2G29420 166 / 6e-52 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10016469 116 / 4e-34 AT2G29420 230 / 2e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10021102 115 / 2e-33 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1)
Lus10016471 114 / 3e-33 AT2G29420 234 / 8e-78 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10040764 112 / 1e-32 AT2G29420 229 / 6e-76 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10040727 112 / 1e-32 AT2G29420 216 / 6e-71 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Lus10040761 111 / 4e-32 AT2G29420 233 / 1e-77 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G104500 108 / 9e-32 AT3G09270 196 / 2e-64 glutathione S-transferase TAU 8 (.1)
Potri.001G437200 106 / 3e-30 AT1G78380 308 / 2e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Potri.010G061200 105 / 5e-30 AT3G09270 202 / 8e-66 glutathione S-transferase TAU 8 (.1)
Potri.001G436600 105 / 8e-30 AT1G78380 318 / 2e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Potri.002G254000 105 / 9e-30 AT2G29420 167 / 1e-51 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Potri.016G118500 105 / 9e-30 AT2G29420 194 / 3e-62 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Potri.010G035500 103 / 5e-29 AT1G10370 301 / 2e-104 GLUTATHIONE S-TRANSFERASE U17, GLUTATHIONE S-TRANSFERASE 30B, GLUTATHIONE S-TRANSFERASE 30, EARLY-RESPONSIVE TO DEHYDRATION 9, GLUTATHIONE S-TRANSFERASE TAU 17, Glutathione S-transferase family protein (.1)
Potri.010G061301 103 / 6e-29 AT2G29420 202 / 9e-66 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Potri.010G061800 102 / 7e-29 AT2G29420 187 / 1e-59 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Potri.008G175000 102 / 1e-28 AT2G29420 177 / 7e-56 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02798 GST_N Glutathione S-transferase, N-terminal domain
Representative CDS sequence
>Lus10040765 pacid=23157641 polypeptide=Lus10040765 locus=Lus10040765.g ID=Lus10040765.BGIv1.0 annot-version=v1.0
ATGGCAGAAGAAGAAGTCAAGCTACTTGGAGCCTGGGCCAGTCCTTTTAACCAGAGGGTAGAAGCAGTTTTCAAACTGAAAGGGTTGAAGTATGAGTTCG
TGCAACAAGACCTTCCGAACAAGAGCGATCTCCTCCTTCAATCCAACCCGATTTACAAGAAGATTCCTGTTCTGATCCACAACGGGAATCCGGTCGTGGA
ATCTCTCGTCATAATGGAGTACATGGACCAAACCTGGCAAAAGACTACCTATCCTTACTGA
AA sequence
>Lus10040765 pacid=23157641 polypeptide=Lus10040765 locus=Lus10040765.g ID=Lus10040765.BGIv1.0 annot-version=v1.0
MAEEEVKLLGAWASPFNQRVEAVFKLKGLKYEFVQQDLPNKSDLLLQSNPIYKKIPVLIHNGNPVVESLVIMEYMDQTWQKTTYPY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Lus10040765 0 1
AT4G15093 catalytic LigB subunit of arom... Lus10034361 1.4 0.9800
AT1G27450 APRT, ATAPT1, A... ARABIDOPSIS THALIANA ADENINE P... Lus10018695 3.5 0.9730
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10025493 3.5 0.9727
AT1G50480 THFS 10-formyltetrahydrofolate synt... Lus10013741 5.5 0.9702
AT4G34710 SPE2, ADC2, ATA... arginine decarboxylase 2 (.1.2... Lus10031079 6.5 0.9650
AT5G16120 alpha/beta-Hydrolases superfam... Lus10009169 6.9 0.9666
AT3G21760 HYR1 HYPOSTATIN RESISTANCE 1, UDP-G... Lus10036086 7.2 0.9713
AT3G52870 IQ calmodulin-binding motif fa... Lus10035595 7.5 0.9569
AT1G80730 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FING... Lus10014350 8.1 0.9598
AT4G21390 B120 S-locus lectin protein kinase ... Lus10006742 9.0 0.9547

Lus10040765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.