Lus10040778 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59600 96 / 6e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 77 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G33760 74 / 4e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G03880 70 / 7e-15 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39680 69 / 3e-14 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 68 / 3e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G55740 68 / 4e-14 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22690 67 / 1e-13 unknown protein
AT3G57430 66 / 2e-13 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39350 66 / 3e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016511 234 / 1e-75 AT5G59600 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033946 76 / 9e-17 AT4G18750 410 / 1e-132 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040504 72 / 2e-15 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000119 71 / 2e-15 AT4G18750 149 / 5e-40 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003383 68 / 8e-15 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10001483 69 / 3e-14 AT5G39680 691 / 0.0 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004303 67 / 3e-14 AT2G21090 146 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10038431 65 / 4e-13 AT4G20770 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018543 64 / 8e-13 AT1G03510 534 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G243800 140 / 4e-40 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G043400 72 / 2e-15 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G212000 70 / 6e-15 AT1G23450 743 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G051300 70 / 8e-15 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G087400 70 / 9e-15 AT4G08210 889 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.004G208000 69 / 1e-14 AT2G03880 939 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G083700 69 / 2e-14 AT3G22690 1050 / 0.0 unknown protein
Potri.017G091600 69 / 2e-14 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.011G052300 69 / 2e-14 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G207500 68 / 3e-14 AT5G37570 602 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10040778 pacid=23157577 polypeptide=Lus10040778 locus=Lus10040778.g ID=Lus10040778.BGIv1.0 annot-version=v1.0
ATGCTTGCTCTTATTAGACCCAGAGTTTTCAGGGACGAACGCAAATTGAGCTTCTACACCGGCGGCCACTCTCGGTTTCATTCATCCCCAGAAGCGTACG
GGGAGATCATCAGAACCTACTCCCGCCGTCGATCGTTACGCAAAGGCAAAGCACTTCACGCTCACCTGATCGTTAACGGATCTGCCCGCCTCACATATCT
CGCAGAAAAGCTCCTGTCTTTCTACACCGAGTGTAGACAGTTGAACAATGCACGCAAACTGTTCGACGAAATTCCTCAATCGAACGTCCGCAGGTGGATA
GTCATCGTGGGTGCCTATTCTCGGTGTGGATTTTACCGGGAAGCTTTGAATGTCTTCTTCGAAATGCAAAAACAAGGACCCTTGCGGCCATGTGTTTGA
AA sequence
>Lus10040778 pacid=23157577 polypeptide=Lus10040778 locus=Lus10040778.g ID=Lus10040778.BGIv1.0 annot-version=v1.0
MLALIRPRVFRDERKLSFYTGGHSRFHSSPEAYGEIIRTYSRRRSLRKGKALHAHLIVNGSARLTYLAEKLLSFYTECRQLNNARKLFDEIPQSNVRRWI
VIVGAYSRCGFYREALNVFFEMQKQGPLRPCV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59600 Tetratricopeptide repeat (TPR)... Lus10040778 0 1
AT2G33680 Tetratricopeptide repeat (TPR)... Lus10005643 2.8 0.7885
AT1G77010 Pentatricopeptide repeat (PPR)... Lus10010146 3.9 0.7297
AT2G03880 REME1 required for efficiency of mit... Lus10005642 6.6 0.7446
AT4G19180 GDA1/CD39 nucleoside phosphata... Lus10039953 118.5 0.6763
AT3G61700 Plant protein 1589 of unknown ... Lus10039340 177.0 0.6390
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10000029 197.9 0.6247
AT3G13770 Pentatricopeptide repeat (PPR)... Lus10040504 260.0 0.6257

Lus10040778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.