Lus10040779 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59600 182 / 5e-56 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G08510 137 / 3e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G21065 133 / 6e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT2G36730 129 / 3e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G19191 130 / 5e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G50990 129 / 7e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G13600 126 / 1e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G29230 126 / 1e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G01510 125 / 3e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 124 / 6e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016511 253 / 4e-83 AT5G59600 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028855 134 / 3e-37 AT4G21300 873 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10008967 133 / 5e-37 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030225 129 / 9e-37 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014298 131 / 2e-36 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10005987 130 / 3e-36 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10010385 130 / 3e-36 AT4G37380 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024971 130 / 7e-36 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015898 129 / 1e-35 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G243800 206 / 7e-65 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G202600 132 / 4e-37 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.007G085500 131 / 2e-36 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.002G175900 128 / 9e-36 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G119000 129 / 2e-35 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G052200 129 / 2e-35 AT2G39620 816 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 127 / 7e-35 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G217900 125 / 2e-34 AT2G22410 530 / 0.0 SLOW GROWTH 1 (.1)
Potri.012G109300 124 / 4e-34 AT5G50990 616 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G072500 124 / 5e-34 AT3G21470 565 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10040779 pacid=23157686 polypeptide=Lus10040779 locus=Lus10040779.g ID=Lus10040779.BGIv1.0 annot-version=v1.0
ATGTACGCGAAATCTGGGTTTCTTCCAGAAGCGAGATCTATTTTCCACAGGACAGCAGAGAAGAACGCTGCTACATGGAATTCGATGATATTCGGGAATG
CAAACAACGGATGCTTGGACGAAGCAATCAGACTGTTTACTCAGATGGAAAATACGGAGGGCGATAGACTCGACCACTTGACTTTCACGGCGGTGTTTAC
TGCTTGTAGTCATGCAGGAATGATCGAGCTCGGACAAAGTCTGTTCGTTATGATGCAACAGAAGTACAAAATTGCTCCGAGATTGGAGCATTACACGTGC
ATGGTGGATCTTCTTGGCAATGCCGGGAAACTTACAGAGGCGTACGACCTGATCAAGACAATTCCTATGGAGCCGGACCTTTTTGCGTGGGGGGGCACTG
TTAGGGGCGTGTAG
AA sequence
>Lus10040779 pacid=23157686 polypeptide=Lus10040779 locus=Lus10040779.g ID=Lus10040779.BGIv1.0 annot-version=v1.0
MYAKSGFLPEARSIFHRTAEKNAATWNSMIFGNANNGCLDEAIRLFTQMENTEGDRLDHLTFTAVFTACSHAGMIELGQSLFVMMQQKYKIAPRLEHYTC
MVDLLGNAGKLTEAYDLIKTIPMEPDLFAWGGTVRGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59600 Tetratricopeptide repeat (TPR)... Lus10040779 0 1
AT3G55400 OVA1 OVULE ABORTION 1, methionyl-tR... Lus10001706 2.8 0.6621
AT3G47530 Pentatricopeptide repeat (PPR)... Lus10000274 3.6 0.7290
AT2G31420 B3 Domain of unknown function (DU... Lus10009354 8.3 0.6792
AT2G40300 ATFER4 ferritin 4 (.1) Lus10017433 16.8 0.6525
AT2G40300 ATFER4 ferritin 4 (.1) Lus10007523 17.7 0.6821
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10009072 23.2 0.5915
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10034583 37.3 0.6608
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10016490 39.1 0.6299
AT1G05590 HEXO2, ATHEX3 BETA-HEXOSAMINIDASE 3, beta-he... Lus10030348 39.9 0.5873
Lus10038177 48.5 0.5823

Lus10040779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.