Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24330 67 / 6e-15 SDG34, ATXR6 SET DOMAIN PROTEIN 34, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 (.1) AT5G09790 61 / 1e-12 PDE336, SDG15, ATXR5 SETDOMAIN GROUP 15, PIGMENT DEFECTIVE 336, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016526 [exp] 102 / 2e-28 AT5G24330 388 / 4e-136 SET DOMAIN PROTEIN 34, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 (.1) Lus10007782 [exp] 77 / 1e-18 AT5G24330 386 / 1e-135 SET DOMAIN PROTEIN 34, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G018300 [exp] 83 / 8e-21 AT5G24330 480 / 3e-171 SET DOMAIN PROTEIN 34, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 (.1) Potri.015G009632 [exp] 83 / 1e-20 AT5G24330 483 / 1e-172 SET DOMAIN PROTEIN 34, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 (.1) Potri.007G109900 [exp] 59 / 8e-12 AT5G09790 473 / 1e-167 SETDOMAIN GROUP 15, PIGMENT DEFECTIVE 336, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 5 (.1.2) Potri.005G058000 [exp] 57 / 2e-11 AT5G09790 481 / 2e-170 SETDOMAIN GROUP 15, PIGMENT DEFECTIVE 336, ARABIDOPSIS TRITHORAX-RELATED PROTEIN 5 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040793 pacid=23157854 polypeptide=Lus10040793 locus=Lus10040793.g ID=Lus10040793.BGIv1.0 annot-version=v1.0 ATGTCGAAAAAGAAGAGAAAGATGCTCCCTTTCAGTCCCACTGATGATCCGGATAAAAGGTTAGAACAGATGAGATCACTAGCGACTGCATTGATAGCCT CGGGAACCCAATTCAGCGATCAGCTTTGTTATCAGCCTGGAATGGCTCTCGCTCTGCTAATTGTGCCTCTTTTGAGAAGGGAGGAATGCAGCTCGTTAAC TACCATTGACTAG
AA sequence Show only first row Show all	>Lus10040793 pacid=23157854 polypeptide=Lus10040793 locus=Lus10040793.g ID=Lus10040793.BGIv1.0 annot-version=v1.0 MSKKKRKMLPFSPTDDPDKRLEQMRSLATALIASGTQFSDQLCYQPGMALALLIVPLLRREECSSLTTID

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24330		SDG34, ATXR6	SET DOMAIN PROTEIN 34, ARABIDO...		Lus10040793 [exp]	0	1
AT4G16807			unknown protein		Lus10010995 [exp]	15.2	0.7779
AT1G78160		APUM7	pumilio 7 (.1)		Lus10041139 [exp]	131.4	0.6842
AT3G06520			agenet domain-containing prote...		Lus10037805 [exp]	240.3	0.6211

Compare expression of checked genes

Lus10040793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.