Lus10040798 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59410 154 / 2e-49 Rab5-interacting family protein (.1)
AT2G29020 114 / 1e-33 Rab5-interacting family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016530 132 / 5e-41 AT5G59410 154 / 1e-49 Rab5-interacting family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G241500 149 / 2e-47 AT5G59410 188 / 6e-63 Rab5-interacting family protein (.1)
Potri.009G032100 147 / 9e-47 AT5G59410 155 / 7e-50 Rab5-interacting family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07019 Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence
>Lus10040798 pacid=23157622 polypeptide=Lus10040798 locus=Lus10040798.g ID=Lus10040798.BGIv1.0 annot-version=v1.0
ATGAAAGAATCCAAATCCACGAAATTGAGTAGCCAGCAGCAAGAGCAGCTACAGCAGCCATTGCAACAGCAGCACCAAAACGGTCATCTGTCTCCTTCCA
AGTTCGCCAAGTTGTTTGATCCCGACGCTTCTTGGGATAAGGCAAGAGATGTGCTGCACTGGATTCGACAGGTGGTGGCCCTGTTGTGTGGATTGATATG
GGGTGCCATCCCTTTGGTAGGCGGCATATGGATTGGAATATTTCTTTTGATATCCTCCGGAATCATTTACGGTTACTACGGAATGATATTACAAGTCGAC
GAAGAAGATTTTGGTGGTCATGGAGCACTCCTCCAAGAGGGGCTCTTTGCTTCAATCACTGTCTTTCTGCTCTCATGGACTCTAGTTTACAGCCTGGCTC
ACTTCTGA
AA sequence
>Lus10040798 pacid=23157622 polypeptide=Lus10040798 locus=Lus10040798.g ID=Lus10040798.BGIv1.0 annot-version=v1.0
MKESKSTKLSSQQQEQLQQPLQQQHQNGHLSPSKFAKLFDPDASWDKARDVLHWIRQVVALLCGLIWGAIPLVGGIWIGIFLLISSGIIYGYYGMILQVD
EEDFGGHGALLQEGLFASITVFLLSWTLVYSLAHF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59410 Rab5-interacting family protei... Lus10040798 0 1
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10032420 1.4 0.9433
AT5G47770 FPS1 farnesyl diphosphate synthase ... Lus10006168 2.0 0.9456
AT2G23070 Protein kinase superfamily pro... Lus10019296 5.5 0.9230
AT5G59410 Rab5-interacting family protei... Lus10016530 9.9 0.9253
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10018575 11.0 0.9310
AT1G50430 ST7R, PA, LE, 7... PARVA, LEPIDA, DWARF 5, DELTA5... Lus10035723 14.3 0.9263
AT1G79650 AtAO1, RAD23B, ... RADIATION SENSITIVE23B, Arabid... Lus10008710 15.6 0.9089
AT4G21105 cytochrome-c oxidases;electron... Lus10006275 17.1 0.9258
AT2G14820 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, M... Lus10033796 17.2 0.9239
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10020499 19.8 0.9170

Lus10040798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.