Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025507 [exp] 42 / 2e-05 AT3G18990 91 / 1e-21 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1) Lus10026724 [exp] 38 / 0.0005 AT4G33280 42 / 2e-04 AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040805 pacid=23157645 polypeptide=Lus10040805 locus=Lus10040805.g ID=Lus10040805.BGIv1.0 annot-version=v1.0 ATGGCTGCATCTTCAAGCCAAGCTTCTGGAAATCCATTCGGATCGGGGCATCCCTACTTCAAGATCAAAATCAGCCCAACTTATCTGAATGCTTGCCAGC GAATGAAGACGTTTCTGCCATTCAGACGACAGTCATCATCCGACTTGGTCTTCACATTTACAACACTTTCGAGGCAACTTCAATTTTACGGAGTAGCTGA CCTTCGGTTGCAGCATCTTTCTCCTAAGAACTCAGGACCATTACTTCTAGTCTATGATCTTGAAATGCACCAACTTACCGCTCCAAGTTCATAA
AA sequence Show only first row Show all	>Lus10040805 pacid=23157645 polypeptide=Lus10040805 locus=Lus10040805.g ID=Lus10040805.BGIv1.0 annot-version=v1.0 MAASSSQASGNPFGSGHPYFKIKISPTYLNACQRMKTFLPFRRQSSSDLVFTFTTLSRQLQFYGVADLRLQHLSPKNSGPLLLVYDLEMHQLTAPSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040805 [exp]	0	1
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10034380 [exp]	1.7	0.8096
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10028440 [exp]	7.7	0.7732
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Lus10029877 [exp]	8.0	0.6777
					Lus10000169 [exp]	8.1	0.7947
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10043274 [exp]	8.5	0.6683
AT1G13030			sphere organelles protein-rela...		Lus10006465 [exp]	8.5	0.8025
AT5G48905		LCR12	low-molecular-weight cysteine-...		Lus10021078 [exp]	10.9	0.8077
					Lus10038619 [exp]	13.0	0.7804
AT1G59840		CCB4	cofactor assembly of complex C...		Lus10010732 [exp]	14.3	0.7696
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10028717 [exp]	14.9	0.7843

Compare expression of checked genes

Lus10040805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.