Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016546 [exp] 79 / 5e-21 AT5G02380 40 / 5e-06 metallothionein 2B (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G239650 [exp] 50 / 1e-09 AT3G09390 60 / 1e-13 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.009G030800 [exp] 45 / 5e-08 AT3G09390 64 / 2e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.019G100001 [exp] 44 / 2e-07 AT3G09390 64 / 4e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.001G041268 [exp] 44 / 3e-07 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.001G040200 [exp] 44 / 3e-07 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1) Potri.013G131200 [exp] 39 / 2e-05 AT3G09390 62 / 2e-14 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01439 [flax] [poplar] Metallothio_2 Metallothionein
Representative CDS sequence Show only first row Show all	>Lus10040811 pacid=23157924 polypeptide=Lus10040811 locus=Lus10040811.g ID=Lus10040811.BGIv1.0 annot-version=v1.0 ATGTCTTGCTGCGGAGGAAAGTGCGGATGCGGCTCAGCCTGCAAGTGCGGCAGTGGCTGTAACGGCTGTGGGATGTACCCAGACCTGGCCGAGGCATCAA CCGCCTCCATCCAGACCATGATCGTCGGAGTTTCTCCTGCCACGAGCTTCGACATGTCGGAGATGAGCTTCGGCGCCGAGGGCGACTGCAAGCGCGGATC CAACTGCACCTGCACCAACTGCGGCTGCGGCAAGTGA
AA sequence Show only first row Show all	>Lus10040811 pacid=23157924 polypeptide=Lus10040811 locus=Lus10040811.g ID=Lus10040811.BGIv1.0 annot-version=v1.0 MSCCGGKCGCGSACKCGSGCNGCGMYPDLAEASTASIQTMIVGVSPATSFDMSEMSFGAEGDCKRGSNCTCTNCGCGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040811 [exp]	0	1
AT2G02130		PDF2.3, LCR68	low-molecular-weight cysteine-...		Lus10004289 [exp]	1.0	0.9553
AT3G06483		ATPDHK, PDK	pyruvate dehydrogenase kinase ...		Lus10018337 [exp]	1.4	0.9422
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10029787 [exp]	3.5	0.9301
AT1G61600			Protein of unknown function (D...		Lus10030977 [exp]	3.7	0.9235
AT1G61930			Protein of unknown function, D...		Lus10020047 [exp]	4.2	0.9354
AT5G66440			unknown protein		Lus10042306 [exp]	4.5	0.9190
AT3G22550			Protein of unknown function (D...		Lus10010568 [exp]	4.7	0.9037
AT2G36330			Uncharacterised protein family...		Lus10002372 [exp]	5.2	0.8997
AT4G24580		REN1	ROP1 ENHANCER 1, Rho GTPase ac...		Lus10036167 [exp]	5.8	0.9096
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10015287 [exp]	6.2	0.9172

Compare expression of checked genes

Lus10040811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.