Lus10040819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 111 / 2e-28 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 108 / 6e-27 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 98 / 3e-23 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61960 98 / 5e-23 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 94 / 9e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 94 / 2e-21 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 92 / 5e-21 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 91 / 2e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 88 / 9e-20 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040820 517 / 0 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 258 / 7e-85 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 250 / 5e-83 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 252 / 4e-82 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 241 / 3e-78 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 232 / 4e-76 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 228 / 7e-74 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10040462 142 / 3e-42 AT5G07900 93 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 140 / 4e-39 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G038500 162 / 3e-47 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 160 / 2e-46 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 159 / 2e-46 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 158 / 7e-46 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 157 / 1e-45 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 152 / 2e-43 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 151 / 2e-43 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 150 / 4e-43 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 150 / 5e-43 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 141 / 3e-39 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10040819 pacid=23157642 polypeptide=Lus10040819 locus=Lus10040819.g ID=Lus10040819.BGIv1.0 annot-version=v1.0
ATGAACCATCCACTTAGATTCCTTCTCGAGAATCGCGGTGTTCATCGGTCACTACTTCCCTACGCTCTCCGGCGATTCTCCAGCGAATCAAGCGCTCCAA
ACATCGCCGCGTCGTACCTCACAAGCGAGTGCGGATTCCGTCCGGAAACCGCCCTCTCCGCCTCCAGGTACGTCACCTTCAAAACTCGAGAAAGAGCCGA
CTCAGTCCTGCGATTCTTCAAAGAAATCGGATTCGCCGATTCCCAAATCCCGAAACTAATCGGGAGGCGTCCGCGGCTGCTAGTGTGCGACCCGGAGAAG
CATTTCGTGCCCAGGATTAAATTCCTGGAATCCAAAGGCTTCACAACTCAAAACATTTTGAAAATGTTGCGTAAATGCCCCGAGATTTTCAACGCCAGCG
TAGAGAACCAGCTGCTCTCTAATTTCAAATACGTTAGAGATGTGATTCAGTGCGAGAACAAAGTCCTTCGTGCCATAACCCGCACCCCGGGTCTGCTAAC
TTGGAAGCTGGAGTCCTGTTTGGTGCCCAACATCAAGATTCTTCGAGAATCCGGCTCGTCTGAATCCAACGTCGTCATGCTGATGCTGTACCAGCCTATG
GTTCTGCTAACTACACAAGATAATTTCTCGCGGGTTGTCGAACGAGTAAAGCAAATGGGGGTGCCTCCCCAGTCGACGACTTTCGGCATAGCGATCCAGG
CAGTGAGAGGAATGAGCGACGAGTTATGGAGAAATAAGGTTGAAGCTTACAAGAAATGGAGTAAGGTTGATGCTTATAAGAAGTGGGGGGGTGGTCTGAT
GAAGTGA
AA sequence
>Lus10040819 pacid=23157642 polypeptide=Lus10040819 locus=Lus10040819.g ID=Lus10040819.BGIv1.0 annot-version=v1.0
MNHPLRFLLENRGVHRSLLPYALRRFSSESSAPNIAASYLTSECGFRPETALSASRYVTFKTRERADSVLRFFKEIGFADSQIPKLIGRRPRLLVCDPEK
HFVPRIKFLESKGFTTQNILKMLRKCPEIFNASVENQLLSNFKYVRDVIQCENKVLRAITRTPGLLTWKLESCLVPNIKILRESGSSESNVVMLMLYQPM
VLLTTQDNFSRVVERVKQMGVPPQSTTFGIAIQAVRGMSDELWRNKVEAYKKWSKVDAYKKWGGGLMK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10040819 0 1
AT1G62981 Protein of unknown function (D... Lus10024481 4.0 0.8719
AT3G06720 IMPA1, IMPA-1, ... importin alpha isoform 1 (.1.2... Lus10037722 4.2 0.8492
AT2G45470 AGP8, FLA8 FASCICLIN-like arabinogalactan... Lus10009235 4.8 0.8894
AT4G38510 ATPase, V1 complex, subunit B ... Lus10005057 5.2 0.8707
AT1G56340 AtCRT1a, CRT1 calreticulin 1a (.1.2) Lus10031410 6.9 0.8518
AT5G16390 CAC1-A, BCCP-1,... BIOTIN CARBOXYL-CARRIER PROTEI... Lus10020619 9.4 0.8654
AT3G60900 FLA10 FASCICLIN-like arabinogalactan... Lus10038005 10.2 0.8589
AT4G22900 Protein of unknown function (D... Lus10001191 13.2 0.8546
AT5G45750 AtRABA1c RAB GTPase homolog A1C (.1) Lus10029253 19.0 0.8186
AT4G38510 ATPase, V1 complex, subunit B ... Lus10027827 19.2 0.8309

Lus10040819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.