Lus10040835 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013984 200 / 4e-64 ND /
Lus10015405 139 / 3e-42 ND /
Lus10031183 66 / 4e-13 ND /
Lus10001105 40 / 0.0005 AT3G06240 109 / 3e-26 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G114900 49 / 4e-07 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1)
Potri.012G099733 46 / 4e-06 AT3G16210 92 / 2e-20 F-box family protein (.1)
Potri.017G012200 40 / 0.0003 AT4G12560 86 / 4e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.006G170300 39 / 0.0008 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10040835 pacid=23157674 polypeptide=Lus10040835 locus=Lus10040835.g ID=Lus10040835.BGIv1.0 annot-version=v1.0
ATGGTGGTGTACACACTTGGCACTGATACCTGGAGGCAGTTGGAAGATTTCTATCATCAAGTTGAGTTGAGTTTTTTCACTGACCGCTACAGGTACTCGA
GTGGATTCGGTTTCTGGTTATGTTGGTCTCGGGCTGCAATGCTAGCGTTCGACTTTAGGACTGAGGTTTTCCATGTGGTAAAAAATCCGGTTCCTCTCCT
TATCCTCGCAGAGGATATCAAAATTCTAATGTCTGGGGATTCGGTTGCTTTACTTGCTCAGCAAGTTGTTGGGAAACCTGGAGGGGAGTTTGATCTGTGG
TTTTTGGATGAAGAACAATGGTGTTGGATCAAACAATCCACTGTTGTCCTTTTGGAATATCATGAAATGTTGTTTGGAGACTGGAGGAAAGTTGAGCTTG
TGGTGTATGATCGTGATAGACATGTGTTGAGGTTGTTCGACCCTGCAACTAAAGCTACTAAAACGTTACTTCAAGGTTGTGATGATAATCTCTTTGATCA
TGCCGTGTTTGCTTACAAAGATAGCTTGATGTCTGTGGGTGATGAGTTTCGATGA
AA sequence
>Lus10040835 pacid=23157674 polypeptide=Lus10040835 locus=Lus10040835.g ID=Lus10040835.BGIv1.0 annot-version=v1.0
MVVYTLGTDTWRQLEDFYHQVELSFFTDRYRYSSGFGFWLCWSRAAMLAFDFRTEVFHVVKNPVPLLILAEDIKILMSGDSVALLAQQVVGKPGGEFDLW
FLDEEQWCWIKQSTVVLLEYHEMLFGDWRKVELVVYDRDRHVLRLFDPATKATKTLLQGCDDNLFDHAVFAYKDSLMSVGDEFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040835 0 1
AT5G45840 Leucine-rich repeat protein ki... Lus10007281 1.4 0.9585
AT4G35420 TKPR1, DRL1 tetraketide alpha-pyrone reduc... Lus10006141 2.0 0.9547
AT2G29880 unknown protein Lus10005028 2.6 0.8275
Lus10009381 3.0 0.9126
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10042691 3.3 0.7849
AT5G25910 AtRLP52 receptor like protein 52 (.1) Lus10016112 3.5 0.8570
AT1G70530 CRK3 cysteine-rich RLK (RECEPTOR-li... Lus10003274 3.5 0.7842
AT3G10910 RING/U-box superfamily protein... Lus10033425 3.7 0.7666
AT5G19360 CPK34 calcium-dependent protein kina... Lus10036050 3.9 0.7661
AT5G21090 Leucine-rich repeat (LRR) fami... Lus10042755 4.0 0.8126

Lus10040835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.