Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59305 36 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016571 [exp] 110 / 2e-33 ND 36 / 2e-04 Lus10005454 [exp] 45 / 1e-07 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G237700 [exp] 46 / 3e-08 AT5G59305 56 / 5e-12 unknown protein Potri.009G029000 [exp] 43 / 1e-06 AT5G59305 51 / 2e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040842 pacid=23157782 polypeptide=Lus10040842 locus=Lus10040842.g ID=Lus10040842.BGIv1.0 annot-version=v1.0 ATGAGTAGCAAGCTTCTCAGATTCCTGCTCTTCGGATGCCTCCTCATCGTTGCTTTGTTCTCCGTCAGTGCAGAGGTTCAAGCTATTGGTTCATACGGTT TCAGAGTCAAGCATGCACACTCAAGGTTACGCAAGGAAGGCTCGTCGCATTGGGGTGGAGAAGAGAAGGTTTGGAAAACTCCATCTGGACCTAACCCAGT CGGAAATCACAATCCACCGATCAAGCAATAG
AA sequence Show only first row Show all	>Lus10040842 pacid=23157782 polypeptide=Lus10040842 locus=Lus10040842.g ID=Lus10040842.BGIv1.0 annot-version=v1.0 MSSKLLRFLLFGCLLIVALFSVSAEVQAIGSYGFRVKHAHSRLRKEGSSHWGGEEKVWKTPSGPNPVGNHNPPIKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040842 [exp]	0	1
AT5G60720			Protein of unknown function, D...		Lus10021450 [exp]	1.7	0.9796
AT1G68200	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10035256 [exp]	2.8	0.9751
AT5G53340			Galactosyltransferase family p...		Lus10033935 [exp]	2.8	0.9694
AT2G33385		ARPC2B	actin-related protein C2B (.1....		Lus10023737 [exp]	2.8	0.9638
AT1G79620			Leucine-rich repeat protein ki...		Lus10023849 [exp]	3.0	0.9706
AT5G05450			P-loop containing nucleoside t...		Lus10040952 [exp]	3.5	0.9656
AT3G53520		ATUXS1, UXS1	UDP-glucuronic acid decarboxyl...		Lus10024436 [exp]	7.2	0.9568
AT5G55950			Nucleotide/sugar transporter f...		Lus10016648 [exp]	7.7	0.9360
AT5G60720			Protein of unknown function, D...		Lus10016114 [exp]	8.4	0.9678
AT4G35240			Protein of unknown function (D...		Lus10016004 [exp]	8.7	0.9520

Compare expression of checked genes

Lus10040842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.