Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59613 96 / 2e-28 unknown protein AT3G46430 96 / 2e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005899 [exp] 118 / 6e-37 AT5G59613 96 / 7e-28 unknown protein Lus10005449 [exp] 114 / 8e-36 AT3G46430 96 / 9e-29 unknown protein Lus10004950 [exp] 114 / 8e-36 AT3G46430 96 / 9e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G053000 [exp] 100 / 4e-30 AT5G59613 92 / 5e-27 unknown protein Potri.010G207600 [exp] 98 / 2e-29 AT5G59613 92 / 4e-27 unknown protein Potri.010G183951 [exp] 38 / 5e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040848 pacid=23157750 polypeptide=Lus10040848 locus=Lus10040848.g ID=Lus10040848.BGIv1.0 annot-version=v1.0 ATGAGGAGGTTGTTCGATCCGTGGCCAGTGTTCTTCAAGCGGGAATGGAATCGCAACTGGCCGTTCCTTGTTGGCTTCGCCGTCACCGGAACCATCATCA CCAAGATGTCTCTCGGCCTCACTGAGGAGGAAGCCAAGAACTCGAAGTTCGTCCAGAGGCACAAGAAGTAG
AA sequence Show only first row Show all	>Lus10040848 pacid=23157750 polypeptide=Lus10040848 locus=Lus10040848.g ID=Lus10040848.BGIv1.0 annot-version=v1.0 MRRLFDPWPVFFKREWNRNWPFLVGFAVTGTIITKMSLGLTEEEAKNSKFVQRHKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59613			unknown protein		Lus10040848 [exp]	0	1
AT2G39960			Microsomal signal peptidase 25...		Lus10009885 [exp]	4.2	0.7235
AT1G15370			SNARE-like superfamily protein...		Lus10002911 [exp]	7.9	0.7374
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10019163 [exp]	8.4	0.7259
AT4G38500			Protein of unknown function (D...		Lus10025082 [exp]	8.7	0.7214
AT1G47820			unknown protein		Lus10035088 [exp]	16.5	0.7220
AT5G49540			Rab5-interacting family protei...		Lus10016182 [exp]	17.7	0.6898
AT1G75420			UDP-Glycosyltransferase superf...		Lus10024281 [exp]	20.1	0.6994
AT1G20080		SYT2, NTMCTYPE1...	synaptotagmin 2, Calcium-depen...		Lus10013563 [exp]	23.2	0.7044
AT1G64850			Calcium-binding EF hand family...		Lus10010653 [exp]	26.9	0.7172
AT5G11600			unknown protein		Lus10001603 [exp]	28.2	0.7148

Compare expression of checked genes

Lus10040848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.