Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 162 / 1e-53 Histone superfamily protein (.1) AT5G59690 162 / 1e-53 Histone superfamily protein (.1) AT3G46320 162 / 1e-53 Histone superfamily protein (.1) AT3G53730 162 / 1e-53 Histone superfamily protein (.1) AT3G45930 162 / 1e-53 Histone superfamily protein (.1) AT2G28740 162 / 1e-53 HIS4 histone H4 (.1) AT1G07820 162 / 1e-53 Histone superfamily protein (.1.2) AT1G07660 162 / 1e-53 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005448 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10041919 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 162 / 1e-53 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 162 / 1e-53 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10025964 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10015492 [exp] 162 / 1e-53 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013300 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10040849 pacid=23157634 polypeptide=Lus10040849 locus=Lus10040849.g ID=Lus10040849.BGIv1.0 annot-version=v1.0 ATGTCTGGCCGCGGCAAGGGAGGCAAAGGACTGGGAAAGGGAGGAGCCAAGAGGCACAGGAAGGTTCTCAGAGACAACATCCAGGGAATCACAAAGCCAG CCATTCGTCGTTTGGCTCGCAGAGGAGGCGTGAAGCGTATCAGTGGTCTCATCTACGAGGAGACTCGCGGTGTTCTCAAGATCTTCTTGGAGAATGTCAT CAGGGACGCCGTCACCTACACCGAGCACGCCAGGAGGAAGACGGTGACTGCTATGGATGTCGTCTATGCTTTGAAGAGGCAAGGAAGGACTCTCTACGGT TTCGGCGGTTAG
AA sequence Show only first row Show all	>Lus10040849 pacid=23157634 polypeptide=Lus10040849 locus=Lus10040849.g ID=Lus10040849.BGIv1.0 annot-version=v1.0 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG FGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53730			Histone superfamily protein (....		Lus10040849 [exp]	0	1
AT3G53730			Histone superfamily protein (....		Lus10005898 [exp]	1.4	0.9637
AT3G53730			Histone superfamily protein (....		Lus10005896 [exp]	2.4	0.9417
AT2G24970			unknown protein		Lus10020094 [exp]	2.6	0.8999
AT1G78650		POLD3	DNA-directed DNA polymerases (...		Lus10039192 [exp]	6.0	0.9055
AT5G35520		MIS12, ATMIS12	MIS12 HOMOLOGUE, ARABIDOPSIS M...		Lus10009652 [exp]	6.0	0.9069
AT1G01370		CENH3, HTR12	CENTROMERIC HISTONE H3, Histon...		Lus10008119 [exp]	6.7	0.8976
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10024838 [exp]	7.1	0.9082
AT4G35150			O-methyltransferase family pro...		Lus10025440 [exp]	10.5	0.8473
AT3G48710			DEK domain-containing chromati...		Lus10016746 [exp]	12.4	0.8776
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Lus10040161 [exp]	13.0	0.8851

Compare expression of checked genes

Lus10040849 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.