Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02570 137 / 1e-43 Histone superfamily protein (.1) AT1G07790 136 / 3e-43 HTB1 Histone superfamily protein (.1) AT3G53650 135 / 4e-43 Histone superfamily protein (.1) AT2G28720 135 / 1e-42 Histone superfamily protein (.1) AT2G37470 134 / 1e-42 Histone superfamily protein (.1) AT3G45980 134 / 3e-42 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 134 / 3e-42 HTB11 Histone superfamily protein (.1) AT5G59910 134 / 3e-42 HTB4 Histone superfamily protein (.1) AT5G22880 133 / 5e-42 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G09480 129 / 8e-41 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040855 [exp] 138 / 7e-44 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10005897 [exp] 137 / 1e-43 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10017456 [exp] 137 / 1e-43 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10005893 [exp] 137 / 1e-43 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10023753 [exp] 135 / 3e-43 AT2G37470 203 / 7e-69 Histone superfamily protein (.1) Lus10037371 [exp] 135 / 1e-42 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10017292 [exp] 134 / 1e-42 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10041347 [exp] 134 / 1e-42 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10016156 [exp] 134 / 1e-42 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G231300 [exp] 137 / 6e-44 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.008G030600 [exp] 137 / 7e-44 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.008G029900 [exp] 137 / 7e-44 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.010G230600 [exp] 137 / 8e-44 AT1G07790 205 / 3e-69 Histone superfamily protein (.1) Potri.010G230801 [exp] 137 / 8e-44 AT1G07790 205 / 2e-69 Histone superfamily protein (.1) Potri.009G028001 [exp] 137 / 9e-44 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091200 [exp] 137 / 9e-44 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.017G123700 [exp] 137 / 1e-43 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091400 [exp] 137 / 1e-43 AT2G28720 186 / 1e-61 Histone superfamily protein (.1) Potri.010G230701 [exp] 137 / 2e-43 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10040850 pacid=23157879 polypeptide=Lus10040850 locus=Lus10040850.g ID=Lus10040850.BGIv1.0 annot-version=v1.0 ATGGGGATCATGAACTCCTTCATCAACGACATCTTCGAGAAACTCGCTCAGGAGTCATCCAGGCTGGCTCGCTACAACAAGAAGCCGACGATTACCTCCA GGGAGATCCAGACTGCCGTCCGATTGGTTCTCCCCGGTGAACTCGCCAAGCACGCCGTTTCTGAAGGGACCAAGGCCGTTACCAAATTCACCAGCTCTTA G
AA sequence Show only first row Show all	>Lus10040850 pacid=23157879 polypeptide=Lus10040850 locus=Lus10040850.g ID=Lus10040850.BGIv1.0 annot-version=v1.0 MGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02570			Histone superfamily protein (....		Lus10040850 [exp]	0	1
AT1G09200			Histone superfamily protein (....		Lus10005270 [exp]	5.3	0.9568
AT3G63030		MBD4	methyl-CPG-binding domain 4 (....		Lus10008176 [exp]	6.2	0.9504
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10004945 [exp]	9.4	0.9476
AT3G12530		PSF2	PSF2 (.1.2)		Lus10002696 [exp]	11.9	0.9179
AT3G48710			DEK domain-containing chromati...		Lus10022439 [exp]	14.4	0.9162
AT3G07170			Sterile alpha motif (SAM) doma...		Lus10022780 [exp]	14.6	0.8953
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10037371 [exp]	14.9	0.9480
AT3G48710			DEK domain-containing chromati...		Lus10025759 [exp]	15.3	0.9060
AT4G27660			unknown protein		Lus10032928 [exp]	16.9	0.9429
					Lus10002045 [exp]	22.1	0.9385

Compare expression of checked genes

Lus10040850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.