Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46020 111 / 3e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G59860 100 / 4e-28 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G73530 72 / 4e-17 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G06210 67 / 2e-15 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G07350 66 / 5e-15 SR45a serine/arginine rich-like protein 45a, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G54580 64 / 2e-14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G19030 64 / 5e-14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G35785 65 / 6e-14 RNA-binding (RRM/RBD/RNP motifs) family protein AT2G37510 63 / 6e-14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G20930 65 / 1e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005891 [exp] 161 / 1e-50 AT3G45980 230 / 1e-76 HISTONE H2B, Histone superfamily protein (.1) Lus10028776 [exp] 72 / 8e-17 AT4G35785 127 / 5e-36 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10017507 [exp] 71 / 3e-16 AT4G35785 123 / 4e-35 RNA-binding (RRM/RBD/RNP motifs) family protein Lus10023758 [exp] 68 / 1e-15 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 67 / 4e-15 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013306 [exp] 65 / 1e-14 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10027035 [exp] 67 / 2e-14 AT3G20930 360 / 8e-123 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10029426 [exp] 67 / 3e-14 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10028400 [exp] 64 / 1e-13 AT4G35785 181 / 2e-57 RNA-binding (RRM/RBD/RNP motifs) family protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G236200 [exp] 83 / 2e-21 AT3G46020 93 / 3e-25 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 78 / 2e-19 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 74 / 4e-18 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 70 / 1e-16 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022280 [exp] 70 / 1e-16 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 69 / 3e-16 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.003G130301 [exp] 70 / 4e-16 AT4G35785 145 / 3e-43 RNA-binding (RRM/RBD/RNP motifs) family protein Potri.009G160300 [exp] 66 / 1e-15 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 69 / 6e-15 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022200 [exp] 68 / 1e-14 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10040854 pacid=23157859 polypeptide=Lus10040854 locus=Lus10040854.g ID=Lus10040854.BGIv1.0 annot-version=v1.0 ATGGCCAGAAGAGCGGGGACGGAGCTCTTCGTTAGCACTGGCACTTCCGCAGGACTGTCGAATTACATAACCAGTCAATCCCTCGAGAAATTGTTCGCAC CGTTCGGCGCGATTGAACAAGCAAGGCTGGTTGTAGATCCAAAAACCAAGAAGCCGAAAGGCTTCGGCTTTGTTAGATTCCAGTCGGAGACCGATGCTCA GAAGGCTCTCAAGGCATTGAACGGCAGGATTATTGACGGGAGACTGATCTTCGTTGAAGTAGCAAAAACTACGAAACCTGGAGATGGATGA
AA sequence Show only first row Show all	>Lus10040854 pacid=23157859 polypeptide=Lus10040854 locus=Lus10040854.g ID=Lus10040854.BGIv1.0 annot-version=v1.0 MARRAGTELFVSTGTSAGLSNYITSQSLEKLFAPFGAIEQARLVVDPKTKKPKGFGFVRFQSETDAQKALKALNGRIIDGRLIFVEVAKTTKPGDG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46020			RNA-binding (RRM/RBD/RNP motif...		Lus10040854 [exp]	0	1
AT3G09890			Ankyrin repeat family protein ...		Lus10014410 [exp]	2.0	0.9043
AT1G52740		HTA9	histone H2A protein 9 (.1)		Lus10043301 [exp]	3.2	0.8899
AT4G22310			Uncharacterised protein family...		Lus10011790 [exp]	4.0	0.9050
AT5G57000			unknown protein		Lus10006884 [exp]	5.7	0.8931
AT2G43080		AT-P4H-1	P4H isoform 1 (.1)		Lus10031048 [exp]	6.3	0.8775
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10000920 [exp]	7.3	0.8884
AT4G30360		ATCNGC17	cyclic nucleotide-gated channe...		Lus10023203 [exp]	7.3	0.8972
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Lus10035780 [exp]	9.5	0.8714
AT4G33380			unknown protein		Lus10006482 [exp]	9.9	0.8192
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10017822 [exp]	12.4	0.8774

Compare expression of checked genes

Lus10040854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.